update range to 10000 bp
locus tag: FAM13496-i1-1.1_000044 genome: FAM13496-i1-1.1
species: Streptococcus thermophilus taxid: 1308

Annotations

Type Name Description Pathways
Gene Code
 secG
Gene Product
 preprotein translocase subunit SecG
Ortholog
 N0.HOG0003492 preprotein translocase subunit SecG
KEGG gene
 K03075 secG; preprotein translocase subunit SecG kornec02024kornec03060kornec03070
Gene Ontology
 GO:0071944 cell periphery
Gene Ontology
 GO:0071806 protein transmembrane transport
Gene Ontology
 GO:0071705 nitrogen compound transport
Gene Ontology
 GO:0071702 organic substance transport
Gene Ontology
 GO:0070727 cellular macromolecule localization
Gene Ontology
 GO:0065002 intracellular protein transmembrane transport
Gene Ontology
 GO:0055085 transmembrane transport
Gene Ontology
 GO:0051649 establishment of localization in cell
Gene Ontology
 GO:0051641 cellular localization
Gene Ontology
 GO:0051234 establishment of localization
Gene Ontology
 GO:0051179 localization
Gene Ontology
 GO:0046907 intracellular transport
Gene Ontology
 GO:0045184 establishment of protein localization
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0043952 protein transport by the Sec complex
Gene Ontology
 GO:0042886 amide transport
Gene Ontology
 GO:0034613 -
Gene Ontology
 GO:0033036 macromolecule localization
Gene Ontology
 GO:0016020 membrane
Gene Ontology
 GO:0015833 peptide transport
Gene Ontology
 GO:0015031 protein transport
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0008104 protein localization
Gene Ontology
 GO:0006886 intracellular protein transport
Gene Ontology
 GO:0006810 transport
Gene Ontology
 GO:0005886 plasma membrane
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005575 cellular_component
Eggnog Protein
 EP:secG
Eggnog Ortholog
 EO:COG1314
Eggnog Description
 ED:Preprotein translocase subunit SecG

Occurs in the following pathway maps:

Pathway Description
kornec02024 Quorum sensing
kornec03060 Protein export
kornec03070 Bacterial secretion system

Sequences

Nucleotide sequence (GC-content: 39.7 %):

ATGTACAACTTATTATTAACGCTGCTCTTGGTTATGTCAGCTATTATTGTGATTGCGGTATTCATGCAGCCACAAAAAAATCCAAGTAGCAATGTCTTTGCTGGTGGTGGGGCAGAAGCACTATTTGAACGTAGTAAACCACGTGGCTTTGAAGCCTTTATGCAACGCTTTACAGGAATCATGGTTTTTCTATGGATTGTAGATGCAATCGTCCTTTCCATTCTCTCAAGTAAGTAA

Protein sequence:

MYNLLLTLLLVMSAIIVIAVFMQPQKNPSSNVFAGGGAEALFERSKPRGFEAFMQRFTGIMVFLWIVDAIVLSILSSK

GenBank Info

gene - secG
locus_tag - FAM13496-i1-1.1_000044
inference - COORDINATES: similar to AA sequence:RefSeq:WP_018374825.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - preprotein translocase subunit SecG
protein_id - extdb:FAM13496-i1-1.1_000044

Gene Locus

Located on scaffold FAM13496-i1-1_scf1

Cellular location expand

Responsible annotations:
SL-0039: GO:0005886 plasma membrane
SL-0162: GO:0016020 membrane
FAM13496-i1-1.1_000043
FAM13496-i1-1.1_000045