update range to 10000 bp
locus tag: FAM13496-i1-1.1_000912 genome: FAM13496-i1-1.1
species: Streptococcus thermophilus taxid: 1308

Annotations

Type Name Description Pathways
Gene Code
 rpmD
Ortholog
 N0.HOG0001324 50S ribosomal protein L30
KEGG gene
 K02907 RP-L30, MRPL30, rpmD; large subunit ribosomal protein L30 kornec03010
Gene Ontology
 GO:1990904 ribonucleoprotein complex
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044446 obsolete intracellular organelle part
Gene Ontology
 GO:0044445 obsolete cytosolic part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044422 obsolete organelle part
Gene Ontology
 GO:0044391 ribosomal subunit
Gene Ontology
 GO:0043232 intracellular non-membrane-bounded organelle
Gene Ontology
 GO:0043229 intracellular organelle
Gene Ontology
 GO:0043228 non-membrane-bounded organelle
Gene Ontology
 GO:0043226 organelle
Gene Ontology
 GO:0032991 protein-containing complex
Gene Ontology
 GO:0022626 cytosolic ribosome
Gene Ontology
 GO:0022625 cytosolic large ribosomal subunit
Gene Ontology
 GO:0015934 large ribosomal subunit
Gene Ontology
 GO:0005840 ribosome
Gene Ontology
 GO:0005829 cytosol
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Eggnog Protein
 EP:rpmD
Eggnog Ortholog
 EO:COG1841
Eggnog Description
 ED:ribosomal protein l30
Gene Product
 50S ribosomal protein L30

Occurs in the following pathway maps:

Pathway Description
kornec03010 Ribosome

Sequences

Nucleotide sequence (GC-content: 39.3 %):

ATGGCTCAAATTAAAATTACTTTGTCTAAGTCTCCAATCGGACGCAAACCAGAACAACGTAAAACAGTTGCTGCTCTTGGACTTGGTAAATTGAATAGCTCAGTTGTTAAAGAAGACAACGCTGCTATCCGTGGTATGGTCAACGCAGTATCTCACTTGGTAACTGTAGAAGACGTTAAATAA

Protein sequence:

MAQIKITLSKSPIGRKPEQRKTVAALGLGKLNSSVVKEDNAAIRGMVNAVSHLVTVEDVK

GenBank Info

gene - rpmD
locus_tag - FAM13496-i1-1.1_000912
inference - COORDINATES: similar to AA sequence:RefSeq:WP_018376783.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 50S ribosomal protein L30
protein_id - extdb:FAM13496-i1-1.1_000912

Gene Locus

Located on scaffold FAM13496-i1-1_scf10

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
FAM13496-i1-1.1_000911
FAM13496-i1-1.1_000913