Annotations

Type Name Description Pathways
Gene Code
rplR
Ortholog
N0.HOG0001326 50S ribosomal protein L18
KEGG gene
K02881 RP-L18, MRPL18, rplR; large subunit ribosomal protein L18 kornec03010
Gene Ontology
GO:1990904 ribonucleoprotein complex
Gene Ontology
GO:1901363 heterocyclic compound binding
Gene Ontology
GO:0097159 organic cyclic compound binding
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044446 obsolete intracellular organelle part
Gene Ontology
GO:0044445 obsolete cytosolic part
Gene Ontology
GO:0044444 obsolete cytoplasmic part
Gene Ontology
GO:0044424 obsolete intracellular part
Gene Ontology
GO:0044422 obsolete organelle part
Gene Ontology
GO:0044391 ribosomal subunit
Gene Ontology
GO:0043232 intracellular non-membrane-bounded organelle
Gene Ontology
GO:0043229 intracellular organelle
Gene Ontology
GO:0043228 non-membrane-bounded organelle
Gene Ontology
GO:0043226 organelle
Gene Ontology
GO:0032991 protein-containing complex
Gene Ontology
GO:0022626 cytosolic ribosome
Gene Ontology
GO:0022625 cytosolic large ribosomal subunit
Gene Ontology
GO:0019843 rRNA binding
Gene Ontology
GO:0015934 large ribosomal subunit
Gene Ontology
GO:0008097 5S rRNA binding
Gene Ontology
GO:0005840 ribosome
Gene Ontology
GO:0005829 cytosol
Gene Ontology
GO:0005737 cytoplasm
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005622 intracellular anatomical structure
Gene Ontology
GO:0005575 cellular_component
Gene Ontology
GO:0005488 binding
Gene Ontology
GO:0003723 RNA binding
Gene Ontology
GO:0003676 nucleic acid binding
Gene Ontology
GO:0003674 molecular_function
Eggnog Protein
EP:rplR
Eggnog Ortholog
EO:COG0256
Eggnog Description
ED:This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit
Gene Product
50S ribosomal protein L18

Occurs in the following pathway maps:

Pathway Description
kornec03010 Ribosome

Sequences

Nucleotide sequence (GC-content: 44.8 %):

GTGATTTCGAAACCAGATAAAAACAAACTCCGCCAAAAACGCCACCGTCGCGTTCGCGGAAAACTCTCTGGAACTGCTGATCGCCCACGTTTGAACATTTTCCGTTCTAATACAGGCATCTACGCTCAAGTAATTGATGACGTAGCGGGTGTAACGCTCGCAAGTGCATCAACTCTTGATAAAGAGGTTTCTAAAGGAACTAAAACAGAACAAGCCATTGTTGTCGGTAAACTTGTTGCTGAACGCGCAGTAGCTAAAGGTATTTCTGAAGTGGTGTTTGACCGCGGTGGATATCTCTATCACGGACGTGTTAAAGCTTTGGCTGACTCAGCTCGTGAAAACGGATTGAAATTCTAA

Protein sequence:

MISKPDKNKLRQKRHRRVRGKLSGTADRPRLNIFRSNTGIYAQVIDDVAGVTLASASTLDKEVSKGTKTEQAIVVGKLVAERAVAKGISEVVFDRGGYLYHGRVKALADSARENGLKF

GenBank Info

gene - rplR
locus_tag - FAM13496-i1-1.1_000914
inference - COORDINATES: similar to AA sequence:RefSeq:NP_687110.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 50S ribosomal protein L18
protein_id - extdb:FAM13496-i1-1.1_000914

Gene Locus

Located on scaffold FAM13496-i1-1_scf10


Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol

FAM13496-i1-1.1_000913
FAM13496-i1-1.1_000915