Annotations

Type Name Description Pathways
Gene Code
rpsS
Ortholog
N0.HOG0001337 30S ribosomal protein S19
KEGG gene
K02965 RP-S19, rpsS; small subunit ribosomal protein S19 kornec03010
Gene Ontology
GO:1990904 ribonucleoprotein complex
Gene Ontology
GO:0071840 cellular component organization or biogenesis
Gene Ontology
GO:0071826 ribonucleoprotein complex subunit organization
Gene Ontology
GO:0070925 organelle assembly
Gene Ontology
GO:0065003 protein-containing complex assembly
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044446 obsolete intracellular organelle part
Gene Ontology
GO:0044445 obsolete cytosolic part
Gene Ontology
GO:0044444 obsolete cytoplasmic part
Gene Ontology
GO:0044424 obsolete intracellular part
Gene Ontology
GO:0044422 obsolete organelle part
Gene Ontology
GO:0044391 ribosomal subunit
Gene Ontology
GO:0044085 cellular component biogenesis
Gene Ontology
GO:0043933 protein-containing complex organization
Gene Ontology
GO:0043232 intracellular non-membrane-bounded organelle
Gene Ontology
GO:0043229 intracellular organelle
Gene Ontology
GO:0043228 non-membrane-bounded organelle
Gene Ontology
GO:0043226 organelle
Gene Ontology
GO:0042274 ribosomal small subunit biogenesis
Gene Ontology
GO:0042255 ribosome assembly
Gene Ontology
GO:0042254 ribosome biogenesis
Gene Ontology
GO:0034622 -
Gene Ontology
GO:0032991 protein-containing complex
Gene Ontology
GO:0022627 cytosolic small ribosomal subunit
Gene Ontology
GO:0022626 cytosolic ribosome
Gene Ontology
GO:0022618 ribonucleoprotein complex assembly
Gene Ontology
GO:0022613 ribonucleoprotein complex biogenesis
Gene Ontology
GO:0022607 cellular component assembly
Gene Ontology
GO:0016043 cellular component organization
Gene Ontology
GO:0015935 small ribosomal subunit
Gene Ontology
GO:0009987 cellular process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0006996 organelle organization
Gene Ontology
GO:0005840 ribosome
Gene Ontology
GO:0005829 cytosol
Gene Ontology
GO:0005737 cytoplasm
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005622 intracellular anatomical structure
Gene Ontology
GO:0005575 cellular_component
Gene Ontology
GO:0005198 structural molecule activity
Gene Ontology
GO:0003735 structural constituent of ribosome
Gene Ontology
GO:0003674 molecular_function
Gene Ontology
GO:0000028 ribosomal small subunit assembly
Eggnog Protein
EP:rpsS
Eggnog Ortholog
EO:COG0185
Eggnog Description
ED:Protein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA
Gene Product
30S ribosomal protein S19

Occurs in the following pathway maps:

Pathway Description
kornec03010 Ribosome

Sequences

Nucleotide sequence (GC-content: 39.1 %):

ATGGGACGTAGTCTTAAAAAAGGACCTTTCGTCGATGGGCATTTGATGAAAAAAGTTGAAGCTCAAGCAAATGACGAAAAGAAAAAAGTAATTAAAACTTGGTCACGTCGTTCAACGATTTTCCCAAGTTTCATCGGATACACTATCGCAGTTTATGATGGACGTAAACATGTTCCTGTTTACATCCAAGAAGACATGGTAGGTCACAAACTTGGTGAATTTGCACCAACTCGTACTTACAAAGGTCATGCAGCTGACGATAAGAAAACACGTCGTTAA

Protein sequence:

MGRSLKKGPFVDGHLMKKVEAQANDEKKKVIKTWSRRSTIFPSFIGYTIAVYDGRKHVPVYIQEDMVGHKLGEFAPTRTYKGHAADDKKTRR

GenBank Info

gene - rpsS
locus_tag - FAM13496-i1-1.1_000926
inference - COORDINATES: similar to AA sequence:RefSeq:WP_000533765.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 30S ribosomal protein S19
protein_id - extdb:FAM13496-i1-1.1_000926

Gene Locus

Located on scaffold FAM13496-i1-1_scf10


Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol

FAM13496-i1-1.1_000925
FAM13496-i1-1.1_000927