Annotations

Type Name Description Pathways
Ortholog
N0.HOG0001339 50S ribosomal protein L23
KEGG gene
K02892 RP-L23, MRPL23, rplW; large subunit ribosomal protein L23 kornec03010
Gene Ontology
GO:1990904 ribonucleoprotein complex
Gene Ontology
GO:1901576 organic substance biosynthetic process
Gene Ontology
GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
GO:1901564 organonitrogen compound metabolic process
Gene Ontology
GO:1901363 heterocyclic compound binding
Gene Ontology
GO:0097159 organic cyclic compound binding
Gene Ontology
GO:0071840 cellular component organization or biogenesis
Gene Ontology
GO:0071826 ribonucleoprotein complex subunit organization
Gene Ontology
GO:0071704 organic substance metabolic process
Gene Ontology
GO:0070925 organelle assembly
Gene Ontology
GO:0065003 protein-containing complex assembly
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044446 obsolete intracellular organelle part
Gene Ontology
GO:0044445 obsolete cytosolic part
Gene Ontology
GO:0044444 obsolete cytoplasmic part
Gene Ontology
GO:0044424 obsolete intracellular part
Gene Ontology
GO:0044422 obsolete organelle part
Gene Ontology
GO:0044391 ribosomal subunit
Gene Ontology
GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
GO:0044267 -
Gene Ontology
GO:0044260 cellular macromolecule metabolic process
Gene Ontology
GO:0044249 cellular biosynthetic process
Gene Ontology
GO:0044238 primary metabolic process
Gene Ontology
GO:0044237 cellular metabolic process
Gene Ontology
GO:0044085 cellular component biogenesis
Gene Ontology
GO:0043933 protein-containing complex organization
Gene Ontology
GO:0043604 amide biosynthetic process
Gene Ontology
GO:0043603 cellular amide metabolic process
Gene Ontology
GO:0043232 intracellular non-membrane-bounded organelle
Gene Ontology
GO:0043229 intracellular organelle
Gene Ontology
GO:0043228 non-membrane-bounded organelle
Gene Ontology
GO:0043226 organelle
Gene Ontology
GO:0043170 macromolecule metabolic process
Gene Ontology
GO:0043043 peptide biosynthetic process
Gene Ontology
GO:0042273 ribosomal large subunit biogenesis
Gene Ontology
GO:0042255 ribosome assembly
Gene Ontology
GO:0042254 ribosome biogenesis
Gene Ontology
GO:0034645 cellular macromolecule biosynthetic process
Gene Ontology
GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
GO:0034622 -
Gene Ontology
GO:0032991 protein-containing complex
Gene Ontology
GO:0022626 cytosolic ribosome
Gene Ontology
GO:0022625 cytosolic large ribosomal subunit
Gene Ontology
GO:0022618 ribonucleoprotein complex assembly
Gene Ontology
GO:0022613 ribonucleoprotein complex biogenesis
Gene Ontology
GO:0022607 cellular component assembly
Gene Ontology
GO:0019538 protein metabolic process
Gene Ontology
GO:0016043 cellular component organization
Gene Ontology
GO:0015934 large ribosomal subunit
Gene Ontology
GO:0010467 gene expression
Gene Ontology
GO:0009987 cellular process
Gene Ontology
GO:0009059 macromolecule biosynthetic process
Gene Ontology
GO:0009058 biosynthetic process
Gene Ontology
GO:0008152 metabolic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0006996 organelle organization
Gene Ontology
GO:0006807 nitrogen compound metabolic process
Gene Ontology
GO:0006518 peptide metabolic process
Gene Ontology
GO:0006412 translation
Gene Ontology
GO:0005840 ribosome
Gene Ontology
GO:0005829 cytosol
Gene Ontology
GO:0005737 cytoplasm
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005622 intracellular anatomical structure
Gene Ontology
GO:0005575 cellular_component
Gene Ontology
GO:0005488 binding
Gene Ontology
GO:0005198 structural molecule activity
Gene Ontology
GO:0003735 structural constituent of ribosome
Gene Ontology
GO:0003723 RNA binding
Gene Ontology
GO:0003676 nucleic acid binding
Gene Ontology
GO:0003674 molecular_function
Gene Ontology
GO:0000027 ribosomal large subunit assembly
Eggnog Protein
EP:rplW
Eggnog Ortholog
EO:COG0089
Eggnog Description
ED:One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome
Gene Product
50S ribosomal protein L23

Occurs in the following pathway maps:

Pathway Description
kornec03010 Ribosome

Sequences

Nucleotide sequence (GC-content: 36.4 %):

ATGAATTTGTATGACGTAATCAAAAAACCTGTTATCACTGAGAAATCTATGATTGCTCTTGAAGCAGGAAAATACACTTTCGAAGTTGATACACGTGCACACAAACTCTTGATCAAACAAGCAGTTGAAGCTGCATTTGAAGGTGTTAAAGTTGCTAGCGTGAACACTGTAACTGTTAAACCAAAACAAAAACGTGTAGGACGTTACACTGGTTTCACTTCAAAAACTAAAAAAGCTATCATCACTCTTACAGCTGATTCTAAAGCAATCGAGTTGTTTGCAGCTGAAGCTGAATAA

Protein sequence:

MNLYDVIKKPVITEKSMIALEAGKYTFEVDTRAHKLLIKQAVEAAFEGVKVASVNTVTVKPKQKRVGRYTGFTSKTKKAIITLTADSKAIELFAAEAE

GenBank Info

locus_tag - FAM13496-i1-1.1_000928
inference - COORDINATES: similar to AA sequence:RefSeq:WP_006739217.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 50S ribosomal protein L23
protein_id - extdb:FAM13496-i1-1.1_000928

Gene Locus

Located on scaffold FAM13496-i1-1_scf10


Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol

FAM13496-i1-1.1_000927
FAM13496-i1-1.1_000929