Annotations

Type Name Description Pathways
Gene Code
rpsO
Ortholog
N0.HOG0001259 30S ribosomal protein S15
KEGG gene
K02956 RP-S15, MRPS15, rpsO; small subunit ribosomal protein S15 kornec03010
Gene Ontology
GO:1990904 ribonucleoprotein complex
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044446 obsolete intracellular organelle part
Gene Ontology
GO:0044445 obsolete cytosolic part
Gene Ontology
GO:0044444 obsolete cytoplasmic part
Gene Ontology
GO:0044424 obsolete intracellular part
Gene Ontology
GO:0044422 obsolete organelle part
Gene Ontology
GO:0044391 ribosomal subunit
Gene Ontology
GO:0043232 intracellular non-membrane-bounded organelle
Gene Ontology
GO:0043229 intracellular organelle
Gene Ontology
GO:0043228 non-membrane-bounded organelle
Gene Ontology
GO:0043226 organelle
Gene Ontology
GO:0032991 protein-containing complex
Gene Ontology
GO:0022627 cytosolic small ribosomal subunit
Gene Ontology
GO:0022626 cytosolic ribosome
Gene Ontology
GO:0015935 small ribosomal subunit
Gene Ontology
GO:0005840 ribosome
Gene Ontology
GO:0005829 cytosol
Gene Ontology
GO:0005737 cytoplasm
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005622 intracellular anatomical structure
Gene Ontology
GO:0005575 cellular_component
Eggnog Protein
EP:rpsO
Eggnog Ortholog
EO:COG0184
Eggnog Description
ED:Forms an intersubunit bridge (bridge B4) with the 23S rRNA of the 50S subunit in the ribosome
Gene Product
30S ribosomal protein S15

Occurs in the following pathway maps:

Pathway Description
kornec03010 Ribosome

Sequences

Nucleotide sequence (GC-content: 42.6 %):

ATGGCAATCTCAAAAGAGAAAAAAAATGAAATCATTGCACAATACGCACGTCACGAAGGTGACACTGGTTCAGTAGAGGTTCAAGTTGCTGTCCTTACTTGGGAAATCAACCACCTTAACGACCATATCAAACAACACAAAAAAGACCACGCTACTTACCGTGGTTTGATGAAAAAAATTGGTCACCGTCGTAACTTGTTGGCATACCTTCGCCGCAAAGACGTTAACCGTTACCGTGAGTTGATCAGCTCACTTGGACTTCGTCGTTAA

Protein sequence:

MAISKEKKNEIIAQYARHEGDTGSVEVQVAVLTWEINHLNDHIKQHKKDHATYRGLMKKIGHRRNLLAYLRRKDVNRYRELISSLGLRR

GenBank Info

gene - rpsO
locus_tag - FAM13496-i1-1.1_001139
inference - COORDINATES: similar to AA sequence:RefSeq:NP_687237.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 30S ribosomal protein S15
protein_id - extdb:FAM13496-i1-1.1_001139

Gene Locus

Located on scaffold FAM13496-i1-1_scf14


Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol

FAM13496-i1-1.1_001138
FAM13496-i1-1.1_001140