update range to 10000 bp
locus tag: FAM13496-i1-1.1_001153 genome: FAM13496-i1-1.1
species: Streptococcus thermophilus taxid: 1308

Annotations

Type Name Description Pathways
KEGG reaction
 R05135 2',3'-Cyclic GMP 3'-nucleotidohydrolase; 2',3'-Cyclic GMP + H2O <=> Guanosine 3'-phosphate kornec00230kornec01100
KEGG reaction
 R03929 2',3'-Cyclic CMP 3'-nucleotidohydrolase; 2',3'-Cyclic CMP + H2O <=> 3'-CMP kornec00240kornec01100
KEGG reaction
 R03538 2',3'-Cyclic UMP 3'-nucleotidohydrolase; 2',3'-Cyclic UMP + H2O <=> 3'-UMP kornec00240kornec01100
KEGG reaction
 R03537 2',3'-Cyclic AMP 3'-nucleotidohydrolase; 2',3'-Cyclic AMP + H2O <=> 3'-AMP kornec00230kornec01100
KEGG reaction
 R02370 cytidine 3'-phosphate phosphohydrolase; 3'-CMP + H2O <=> Cytidine + Orthophosphate kornec00240kornec01100
KEGG reaction
 R02148 guanosine 3'-phosphate phosphohydrolase; Guanosine 3'-phosphate + H2O <=> Guanosine + Orthophosphate kornec00230kornec01100
KEGG reaction
 R01877 uridine 3'-monophosphate phosphohydrolase; 3'-UMP + H2O <=> Uridine + Orthophosphate kornec00240kornec01100
KEGG reaction
 R01562 adenosine 3'-phosphate phosphohydrolase; 3'-AMP + H2O <=> Adenosine + Orthophosphate kornec00230kornec01100
Ortholog
 N0.HOG0003466 bifunctional metallophosphatase/5'-nucleotidase
KEGG gene
 K01119 cpdB; 2',3'-cyclic-nucleotide 2'-phosphodiesterase / 3'-nucleotidase [EC:3.1.4.16 3.1.3.6] kornec00230kornec00240kornec01100
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901575 organic substance catabolic process
Gene Ontology
 GO:1901362 organic cyclic compound biosynthetic process
Gene Ontology
 GO:1901361 organic cyclic compound catabolic process
Gene Ontology
 GO:1901360 organic cyclic compound metabolic process
Gene Ontology
 GO:1901292 nucleoside phosphate catabolic process
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0055086 nucleobase-containing small molecule metabolic process
Gene Ontology
 GO:0051716 cellular response to stimulus
Gene Ontology
 GO:0050896 response to stimulus
Gene Ontology
 GO:0046700 heterocycle catabolic process
Gene Ontology
 GO:0046483 heterocycle metabolic process
Gene Ontology
 GO:0046434 organophosphate catabolic process
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044283 small molecule biosynthetic process
Gene Ontology
 GO:0044281 small molecule metabolic process
Gene Ontology
 GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
 GO:0044270 cellular nitrogen compound catabolic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044248 cellular catabolic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0042597 periplasmic space
Gene Ontology
 GO:0042578 phosphoric ester hydrolase activity
Gene Ontology
 GO:0034655 nucleobase-containing compound catabolic process
Gene Ontology
 GO:0034654 nucleobase-containing compound biosynthetic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0034404 nucleobase-containing small molecule biosynthetic process
Gene Ontology
 GO:0033554 cellular response to stress
Gene Ontology
 GO:0031975 envelope
Gene Ontology
 GO:0030313 cell envelope
Gene Ontology
 GO:0030288 outer membrane-bounded periplasmic space
Gene Ontology
 GO:0019637 organophosphate metabolic process
Gene Ontology
 GO:0019439 aromatic compound catabolic process
Gene Ontology
 GO:0019438 aromatic compound biosynthetic process
Gene Ontology
 GO:0018130 heterocycle biosynthetic process
Gene Ontology
 GO:0016791 phosphatase activity
Gene Ontology
 GO:0016788 hydrolase activity, acting on ester bonds
Gene Ontology
 GO:0016787 hydrolase activity
Gene Ontology
 GO:0016311 dephosphorylation
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009166 nucleotide catabolic process
Gene Ontology
 GO:0009117 nucleotide metabolic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0009056 catabolic process
Gene Ontology
 GO:0008663 2',3'-cyclic-nucleotide 2'-phosphodiesterase activity
Gene Ontology
 GO:0008254 3'-nucleotidase activity
Gene Ontology
 GO:0008252 nucleotidase activity
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0008081 phosphoric diester hydrolase activity
Gene Ontology
 GO:0006974 cellular response to DNA damage stimulus
Gene Ontology
 GO:0006950 response to stress
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006796 phosphate-containing compound metabolic process
Gene Ontology
 GO:0006793 phosphorus metabolic process
Gene Ontology
 GO:0006753 nucleoside phosphate metabolic process
Gene Ontology
 GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
 GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0004112 cyclic-nucleotide phosphodiesterase activity
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:cpdB
Eggnog Ortholog
 EO:COG0737
Eggnog Description
 ED:nucleotide catabolic process
EC Number
 EC:3.1.4.16 2',3'-cyclic-nucleotide 2'-phosphodiesterase; ribonucleoside 2',3'-cyclic phosphate diesterase; 2',3 '-cyclic AMP phosphodiesterase; 2',3'-cyclic nucleotidase; cyclic 2',3'-nucleotide 2'-phosphodiesterase; cyclic 2',3'-nucleotide phosphodiesterase; 2',3'-cyclic nucleoside monophosphate phosphodiesterase; 2',3'-cyclic AMP 2'-phosphohydrolase; cyclic phosphodiesterase:3'-nucleotidase; 2',3'-cyclic nucleotide phosphohydrolase; 2':3'-cyclic phosphodiesterase; 2':3'-cyclic nucleotide phosphodiesterase:3'-nucleotidase kornec00230kornec00240kornec01100
EC Number
 EC:3.1.3.6 3'-nucleotidase; 3'-mononucleotidase; 3'-phosphatase; 3'-ribonucleotidase kornec00230kornec00240kornec01100
Gene Product
 diguanylate phosphodiesterase

Occurs in the following pathway maps:

Pathway Description
kornec00230 Purine metabolism
kornec00240 Pyrimidine metabolism
kornec01100 Metabolic pathways

Sequences

Nucleotide sequence (GC-content: 42.3 %):

ATGATTCAAGGAACTCCTTTTGGAACTTATAAGGCCTTGATTGATCCTGTTGCCCAAGGTGAGACTCACCCTATGTACAAGGCTTTTGAGATGCTTGGTTACGATGCTGAAACGCTTGGAAATCACGAGTTTAACTTATGGCCTCGAATTTTTGGATCGCATGGTTAA

Protein sequence:

MIQGTPFGTYKALIDPVAQGETHPMYKAFEMLGYDAETLGNHEFNLWPRIFGSHG

GenBank Info

locus_tag - FAM13496-i1-1.1_001153
inference - COORDINATES: similar to AA sequence:RefSeq:WP_014607882.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - diguanylate phosphodiesterase
protein_id - extdb:FAM13496-i1-1.1_001153

Gene Locus

Located on scaffold FAM13496-i1-1_scf14

Cellular location expand

Responsible annotations:
SL-0036: GO:0031975 envelope
SL-0200: GO:0042597 periplasmic space
FAM13496-i1-1.1_001152
FAM13496-i1-1.1_001154