update range to 10000 bp
locus tag: FAM13496-i1-1.1_001212 genome: FAM13496-i1-1.1
species: Streptococcus thermophilus taxid: 1308

Annotations

Type Name Description Pathways
Gene Product
 tRNA (guanosine(46)-N7)-methyltransferase TrmB
Gene Code
 trmB
Ortholog
 N0.HOG0001222 tRNA (guanosine(46)-N7)-methyltransferase TrmB
KEGG gene
 K03439 trmB, METTL1, TRM8; tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Gene Ontology
 GO:1990234 transferase complex
Gene Ontology
 GO:1902494 catalytic complex
Gene Ontology
 GO:1901360 organic cyclic compound metabolic process
Gene Ontology
 GO:0140101 catalytic activity, acting on a tRNA
Gene Ontology
 GO:0140098 catalytic activity, acting on RNA
Gene Ontology
 GO:0106004 tRNA (guanine-N7)-methylation
Gene Ontology
 GO:0090304 nucleic acid metabolic process
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0046483 heterocycle metabolic process
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044260 cellular macromolecule metabolic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0043527 tRNA methyltransferase complex
Gene Ontology
 GO:0043414 macromolecule methylation
Gene Ontology
 GO:0043412 macromolecule modification
Gene Ontology
 GO:0043170 macromolecule metabolic process
Gene Ontology
 GO:0036265 RNA (guanine-N7)-methylation
Gene Ontology
 GO:0034708 methyltransferase complex
Gene Ontology
 GO:0034660 ncRNA metabolic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0034470 ncRNA processing
Gene Ontology
 GO:0032991 protein-containing complex
Gene Ontology
 GO:0032259 methylation
Gene Ontology
 GO:0030488 tRNA methylation
Gene Ontology
 GO:0016741 transferase activity, transferring one-carbon groups
Gene Ontology
 GO:0016740 transferase activity
Gene Ontology
 GO:0016423 tRNA (guanine) methyltransferase activity
Gene Ontology
 GO:0016070 RNA metabolic process
Gene Ontology
 GO:0010467 gene expression
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009451 RNA modification
Gene Ontology
 GO:0008757 S-adenosylmethionine-dependent methyltransferase activity
Gene Ontology
 GO:0008176 tRNA (guanine-N7-)-methyltransferase activity
Gene Ontology
 GO:0008175 tRNA methyltransferase activity
Gene Ontology
 GO:0008173 RNA methyltransferase activity
Gene Ontology
 GO:0008168 methyltransferase activity
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0008033 tRNA processing
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
 GO:0006400 tRNA modification
Gene Ontology
 GO:0006399 tRNA metabolic process
Gene Ontology
 GO:0006396 RNA processing
Gene Ontology
 GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0001510 RNA methylation
Eggnog Protein
 EP:trmB
Eggnog Ortholog
 EO:COG0220
Eggnog Description
 ED:Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA
EC Number
 EC:2.1.1.33 tRNA (guanine46-N7)-methyltransferase; Trm8/Trm82; TrmB; tRNA (m7G46) methyltransferase; transfer ribonucleate guanine 7-methyltransferase; 7-methylguanine transfer ribonucleate methylase; tRNA guanine 7-methyltransferase; N7-methylguanine methylase; S-adenosyl-L-methionine:tRNA (guanine-7-N-)-methyltransferase

Sequences

Nucleotide sequence (GC-content: 41.4 %):

ATGCGAGTTAGAAAACGTAAAGGTGCAGAGGAACACCTAGCTAACCATCCTCAGTATGTTATCCTTGAGCCGGAAGCTGCTAAAGGTAAGTGGCACCAGATTTTTGGCAATGACAATCCTATCCATATTGAGGTGGGGTCTGGTAAGGGAGCCTTCATTACTGGAATGGCCCAACAAAATCCTGATATCAACTACATTGGTATTGATATCCAGTTATCTGTTTTGAGTTATGCCTTGGACAAGGTCTTGGCCTCAGGTGTTGAAAATGTCAAACTCTTGCGTGTGGATGGATCTGCTTTGACCAACTATTTTGAAGATGGTGAAGTGGACATGATGTATCTCAACTTCTCAGATCCATGGCCCAAGAGCCGTCACGAGAAACGTCGTTTGACCTACAAGACTTTCCTAGATACTTATAAGCAAATTTTGCCTAAAAATGGAGAGATTCACTTAAAGACAGACAATCGAGGATTTTTCGAATACAGTTTGACGAGTTTCTCACAGTATGGAATGATTCTTAACAAAGTGTGGTTGGATCTTCATGCAAGTGATTATGAGGGCAACGTTATGACTGAGTACGAGCGAAAGTTTTCAGAAAAAGGTCAAGCTATCTACCGAGTAGAGGCTCAGTTTAAAGATTAA

Protein sequence:

MRVRKRKGAEEHLANHPQYVILEPEAAKGKWHQIFGNDNPIHIEVGSGKGAFITGMAQQNPDINYIGIDIQLSVLSYALDKVLASGVENVKLLRVDGSALTNYFEDGEVDMMYLNFSDPWPKSRHEKRRLTYKTFLDTYKQILPKNGEIHLKTDNRGFFEYSLTSFSQYGMILNKVWLDLHASDYEGNVMTEYERKFSEKGQAIYRVEAQFKD

GenBank Info

gene - trmB
locus_tag - FAM13496-i1-1.1_001212
EC_number - 2.1.1.33
inference - COORDINATES: similar to AA sequence:RefSeq:WP_008535383.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - tRNA (guanosine(46)-N7)-methyltransferase TrmB
protein_id - extdb:FAM13496-i1-1.1_001212

Gene Locus

Located on scaffold FAM13496-i1-1_scf15

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
FAM13496-i1-1.1_001211
FAM13496-i1-1.1_001213