Annotations

Type Name Description Pathways
KEGG reaction
R02718 D-Alanine:poly(ribitol phosphate) ligase (AMP-forming); ATP + D-Alanine + Poly(ribitol phosphate) <=> AMP + Diphosphate + O-D-Alanyl-poly(ribitol phosphate) kornec00473kornec01100
Ortholog
N0.HOG0003541 D-alanine--poly(phosphoribitol) ligase subunit DltC
KEGG gene
K14188 dltC; D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13] kornec00473kornec01100kornec01503kornec02020kornec05150
Gene Ontology
GO:1901576 organic substance biosynthetic process
Gene Ontology
GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
GO:1901564 organonitrogen compound metabolic process
Gene Ontology
GO:1901137 carbohydrate derivative biosynthetic process
Gene Ontology
GO:1901135 carbohydrate derivative metabolic process
Gene Ontology
GO:0071840 cellular component organization or biogenesis
Gene Ontology
GO:0071704 organic substance metabolic process
Gene Ontology
GO:0071554 cell wall organization or biogenesis
Gene Ontology
GO:0070589 cellular component macromolecule biosynthetic process
Gene Ontology
GO:0055085 transmembrane transport
Gene Ontology
GO:0051234 establishment of localization
Gene Ontology
GO:0051179 localization
Gene Ontology
GO:0044260 cellular macromolecule metabolic process
Gene Ontology
GO:0044249 cellular biosynthetic process
Gene Ontology
GO:0044237 cellular metabolic process
Gene Ontology
GO:0044085 cellular component biogenesis
Gene Ontology
GO:0044038 cell wall macromolecule biosynthetic process
Gene Ontology
GO:0044036 cell wall macromolecule metabolic process
Gene Ontology
GO:0043170 macromolecule metabolic process
Gene Ontology
GO:0042546 cell wall biogenesis
Gene Ontology
GO:0034645 cellular macromolecule biosynthetic process
Gene Ontology
GO:0030203 glycosaminoglycan metabolic process
Gene Ontology
GO:0022857 transmembrane transporter activity
Gene Ontology
GO:0009987 cellular process
Gene Ontology
GO:0009273 peptidoglycan-based cell wall biogenesis
Gene Ontology
GO:0009252 peptidoglycan biosynthetic process
Gene Ontology
GO:0009059 macromolecule biosynthetic process
Gene Ontology
GO:0009058 biosynthetic process
Gene Ontology
GO:0008152 metabolic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0006810 transport
Gene Ontology
GO:0006807 nitrogen compound metabolic process
Gene Ontology
GO:0006024 glycosaminoglycan biosynthetic process
Gene Ontology
GO:0006023 aminoglycan biosynthetic process
Gene Ontology
GO:0006022 aminoglycan metabolic process
Gene Ontology
GO:0005215 transporter activity
Gene Ontology
GO:0003674 molecular_function
Gene Ontology
GO:0000270 peptidoglycan metabolic process
Eggnog Protein
EP:dltC
Eggnog Ortholog
EO:COG0236
Eggnog Description
ED:Carrier protein involved in the D-alanylation of lipoteichoic acid (LTA). The loading of thioester-linked D-alanine onto DltC is catalyzed by D-alanine--D-alanyl carrier protein ligase DltA. The DltC-carried D-alanyl group is further transferred to cell membrane phosphatidylglycerol (PG) by forming an ester bond
EC Number
EC:6.1.1.13 D-alanine---poly(phosphoribitol) ligase; D-alanyl-poly(phosphoribitol) synthetase; D-alanine: membrane acceptor ligase; D-alanine-D-alanyl carrier protein ligase; D-alanine-membrane acceptor ligase; D-alanine-activating enzyme kornec00473kornec01100
Gene Code
dltC
Gene Product
D-alanine--poly(phosphoribitol) ligase subunit DltC

Occurs in the following pathway maps:

Pathway Description
kornec00473 D-Alanine metabolism
kornec01100 Metabolic pathways
kornec01503 Cationic antimicrobial peptide (CAMP) resistance
kornec02020 Two-component system
kornec05150 Staphylococcus aureus infection

Sequences

Nucleotide sequence (GC-content: 37.9 %):

ATGGATGTAAAAGCAGAAGTCATTGAAATTATTGATGAACTGTTCATGGAAGATGTATCTGACATGATGGATGAAGACCTTTTTGATGCTGGTGTTCTTGATTCAATGGGAACTGTTGAACTTATCGTTGAATTGGAATCACGTTTTGATATTCGTGTCCCAGTTTCAGAATTTGGTCGTGATGATTGGAACACAGCTAATAAGATTGTTGAAGGGGTAACGGAGCTTCGCAATGCTTAA

Protein sequence:

MDVKAEVIEIIDELFMEDVSDMMDEDLFDAGVLDSMGTVELIVELESRFDIRVPVSEFGRDDWNTANKIVEGVTELRNA

GenBank Info

gene - dltC
locus_tag - FAM13496-i1-1.1_001223
EC_number - 6.1.1.13
inference - COORDINATES: similar to AA sequence:RefSeq:WP_005591431.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - D-alanine--poly(phosphoribitol) ligase subunit DltC
protein_id - extdb:FAM13496-i1-1.1_001223

Gene Locus

Located on scaffold FAM13496-i1-1_scf16


FAM13496-i1-1.1_001222
FAM13496-i1-1.1_001224