update range to 10000 bp
locus tag: FAM13496-i1-1.1_001458 genome: FAM13496-i1-1.1
species: Streptococcus thermophilus taxid: 1308

Annotations

Type Name Description Pathways
KEGG reaction
 R01728 prephenate:NAD+ oxidoreductase(decarboxylating); Prephenate + NAD+ <=> 3-(4-Hydroxyphenyl)pyruvate + CO2 + NADH + H+ kornec00400kornec00401kornec01100kornec01110kornec01230
KEGG reaction
 R01715 Chorismate pyruvatemutase; Chorismate <=> Prephenate kornec00400kornec01100kornec01110kornec01230
KEGG reaction
 R01373 prephenate hydro-lyase (decarboxylating; phenylpyruvate-forming); Prephenate <=> Phenylpyruvate + H2O + CO2 kornec00400kornec01100kornec01110kornec01230
KEGG reaction
 R00691 L-arogenate hydro-lyase (decarboxylating; L-phenylalanine-forming); L-Arogenate <=> L-Phenylalanine + H2O + CO2 kornec00400kornec01100kornec01110kornec01230
Ortholog
 N0.HOG0001693 chorismate mutase
KEGG gene
 K14187 tyrA; chorismate mutase / prephenate dehydrogenase [EC:5.4.99.5 1.3.1.12] kornec00400kornec00401kornec01100kornec01110kornec01230
KEGG gene
 K14170 pheA; chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51] kornec00400kornec01100kornec01110kornec01230
KEGG gene
 K04516 AROA1, aroA; chorismate mutase [EC:5.4.99.5] kornec00400kornec01100kornec01110kornec01230
KEGG gene
 K04093 pheA1; chorismate mutase [EC:5.4.99.5] kornec00400kornec01100kornec01110kornec01230
KEGG gene
 K04092 tyrA1; chorismate mutase [EC:5.4.99.5] kornec00400kornec01100kornec01110kornec01230
KEGG gene
 K00661 maa; maltose O-acetyltransferase [EC:2.3.1.79]
Gene Ontology
 GO:1902223 erythrose 4-phosphate/phosphoenolpyruvate family amino acid biosynthetic process
Gene Ontology
 GO:1902221 erythrose 4-phosphate/phosphoenolpyruvate family amino acid metabolic process
Gene Ontology
 GO:1901607 alpha-amino acid biosynthetic process
Gene Ontology
 GO:1901605 alpha-amino acid metabolic process
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:1901362 organic cyclic compound biosynthetic process
Gene Ontology
 GO:1901360 organic cyclic compound metabolic process
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0046394 carboxylic acid biosynthetic process
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044283 small molecule biosynthetic process
Gene Ontology
 GO:0044281 small molecule metabolic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0043436 oxoacid metabolic process
Gene Ontology
 GO:0019752 carboxylic acid metabolic process
Gene Ontology
 GO:0019438 aromatic compound biosynthetic process
Gene Ontology
 GO:0017144 -
Gene Ontology
 GO:0016866 intramolecular transferase activity
Gene Ontology
 GO:0016853 isomerase activity
Gene Ontology
 GO:0016836 hydro-lyase activity
Gene Ontology
 GO:0016835 carbon-oxygen lyase activity
Gene Ontology
 GO:0016829 lyase activity
Gene Ontology
 GO:0016053 organic acid biosynthetic process
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009095 aromatic amino acid family biosynthetic process, prephenate pathway
Gene Ontology
 GO:0009094 L-phenylalanine biosynthetic process
Gene Ontology
 GO:0009073 aromatic amino acid family biosynthetic process
Gene Ontology
 GO:0009072 aromatic amino acid family metabolic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0008652 cellular amino acid biosynthetic process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
 GO:0006571 tyrosine biosynthetic process
Gene Ontology
 GO:0006570 tyrosine metabolic process
Gene Ontology
 GO:0006558 L-phenylalanine metabolic process
Gene Ontology
 GO:0006520 cellular amino acid metabolic process
Gene Ontology
 GO:0006082 organic acid metabolic process
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0004664 prephenate dehydratase activity
Gene Ontology
 GO:0004106 chorismate mutase activity
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:pheA
Eggnog Ortholog
 EO:COG1605
Eggnog Description
 ED:Chorismate mutase
EC Number
 EC:5.4.99.5 chorismate mutase; hydroxyphenylpyruvate synthase kornec00400kornec01100kornec01110
EC Number
 EC:4.2.1.51 prephenate dehydratase; prephenate hydro-lyase (decarboxylating) kornec00400kornec01100kornec01110
EC Number
 EC:2.3.1.79 maltose O-acetyltransferase; maltose transacetylase; maltose O-acetyltransferase; MAT
EC Number
 EC:1.3.1.12 prephenate dehydrogenase; hydroxyphenylpyruvate synthase; chorismate mutase---prephenate dehydrogenase kornec00400kornec00401kornec01100kornec01110
Gene Product
 chorismate mutase

Occurs in the following pathway maps:

Pathway Description
kornec00400 Phenylalanine, tyrosine and tryptophan biosynthesis
kornec00401 Novobiocin biosynthesis
kornec01100 Metabolic pathways
kornec01110 Biosynthesis of secondary metabolites
kornec01230 Biosynthesis of amino acids

Sequences

Nucleotide sequence (GC-content: 40.7 %):

ATGGACTTAAATGAGATTCGCCAACAGATTGACTCCGTTGATAATGAGATTGTGGCTTTGTTGGAAGAACGTATGAAATTGGTAACTCGAGTAAGTGCTTATAAACAACGCACTGGAAAGGCGATTTATGATCCCGAACGAGAGCAAGCCCTGCTAGACAAGGTAGGCGCTAGTGTTCTTAATCCTGAATATAAAGAAGCTATCGTCGCAAGTTTTGCGGATATTATGAAGCATTCACGTACTTATCAAGCAAGTAAGCTAGAAGAAAAGTAG

Protein sequence:

MDLNEIRQQIDSVDNEIVALLEERMKLVTRVSAYKQRTGKAIYDPEREQALLDKVGASVLNPEYKEAIVASFADIMKHSRTYQASKLEEK

GenBank Info

locus_tag - FAM13496-i1-1.1_001458
EC_number - 5.4.99.5
inference - COORDINATES: similar to AA sequence:RefSeq:WP_011681230.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - chorismate mutase
protein_id - extdb:FAM13496-i1-1.1_001458

Gene Locus

Located on scaffold FAM13496-i1-1_scf21

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
FAM13496-i1-1.1_001457
FAM13496-i1-1.1_001459