FAM13496-i1-1.1_001460 - OpenGenomeBrowser

locus tag: FAM13496-i1-1.1_001460 genome: FAM13496-i1-1.1
species: Streptococcus thermophilus taxid: 1308

Annotations

Type	Name	Description	Pathways
Gene Code	rplS
Ortholog	N0.HOG0001246	50S ribosomal protein L19
KEGG gene	K02884	RP-L19, MRPL19, rplS; large subunit ribosomal protein L19	kornec03010
Gene Ontology	GO:1990904	ribonucleoprotein complex
Gene Ontology	GO:0044464	obsolete cell part
Gene Ontology	GO:0044446	obsolete intracellular organelle part
Gene Ontology	GO:0044445	obsolete cytosolic part
Gene Ontology	GO:0044444	obsolete cytoplasmic part
Gene Ontology	GO:0044424	obsolete intracellular part
Gene Ontology	GO:0044422	obsolete organelle part
Gene Ontology	GO:0044391	ribosomal subunit
Gene Ontology	GO:0043232	intracellular non-membrane-bounded organelle
Gene Ontology	GO:0043229	intracellular organelle
Gene Ontology	GO:0043228	non-membrane-bounded organelle
Gene Ontology	GO:0043226	organelle
Gene Ontology	GO:0032991	protein-containing complex
Gene Ontology	GO:0022626	cytosolic ribosome
Gene Ontology	GO:0022625	cytosolic large ribosomal subunit
Gene Ontology	GO:0015934	large ribosomal subunit
Gene Ontology	GO:0005840	ribosome
Gene Ontology	GO:0005829	cytosol
Gene Ontology	GO:0005737	cytoplasm
Gene Ontology	GO:0005623	obsolete cell
Gene Ontology	GO:0005622	intracellular anatomical structure
Gene Ontology	GO:0005575	cellular_component
Gene Ontology	GO:0005198	structural molecule activity
Gene Ontology	GO:0003735	structural constituent of ribosome
Gene Ontology	GO:0003674	molecular_function
Eggnog Protein	EP:rplS
Eggnog Ortholog	EO:COG0335
Eggnog Description	ED:This protein is located at the 30S-50S ribosomal subunit interface and may play a role in the structure and function of the aminoacyl-tRNA binding site
Gene Product	50S ribosomal protein L19

Occurs in the following pathway maps:

Pathway	Description
kornec03010	Ribosome

Sequences

Nucleotide sequence (GC-content: 43.7 %):

ATGAATCCATTGATCCAAAGTTTGACAGAAGGTCAACTTCGTACTGACATCCCATCATTCCGTCCTGGTGACACTGTTCGCGTTCACGCAAAAGTTGTCGAAGGAACTCGCGAACGTATCCAGATCTTTGAAGGTGTAGTTATTTCACGCAAAGGTCAAGGGATCTCAGAAATGTACACAGTTCGTAAAATCTCAAGCGGTATCGGTGTAGAACGTACTTTCCCAATCCACACTCCACGTGTTGATAAGATTGAAGTTGTACGCTACGGTAAAGTCCGCCGTGCTAAACTTTACTACTTGCGTGCTTTGCAAGGTAAAGCTGCACGTATCAAAGAAATCCGTAAATAA

Protein sequence:

MNPLIQSLTEGQLRTDIPSFRPGDTVRVHAKVVEGTRERIQIFEGVVISRKGQGISEMYTVRKISSGIGVERTFPIHTPRVDKIEVVRYGKVRRAKLYYLRALQGKAARIKEIRK

GenBank Info

gene - rplS
locus_tag - FAM13496-i1-1.1_001460
inference - COORDINATES: similar to AA sequence:RefSeq:WP_005590628.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 50S ribosomal protein L19
protein_id - extdb:FAM13496-i1-1.1_001460

Gene Locus

Located on scaffold FAM13496-i1-1_scf21

Cellular location

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol