update range to 10000 bp
locus tag: FAM13496-i1-1.1_001503 genome: FAM13496-i1-1.1
species: Streptococcus thermophilus taxid: 1308

Annotations

Type Name Description Pathways
Gene Product
 rod shape-determining protein MreD
Ortholog
 N0.HOG0003611 rod shape-determining protein MreD
Gene Code
 mreD
KEGG gene
 K03571 mreD; rod shape-determining protein MreD
Gene Ontology
 GO:0071944 cell periphery
Gene Ontology
 GO:0065008 regulation of biological quality
Gene Ontology
 GO:0065007 biological regulation
Gene Ontology
 GO:0051128 regulation of cellular component organization
Gene Ontology
 GO:0050794 regulation of cellular process
Gene Ontology
 GO:0050793 regulation of developmental process
Gene Ontology
 GO:0050789 regulation of biological process
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044459 obsolete plasma membrane part
Gene Ontology
 GO:0044425 obsolete membrane part
Gene Ontology
 GO:0031226 intrinsic component of plasma membrane
Gene Ontology
 GO:0031224 intrinsic component of membrane
Gene Ontology
 GO:0022604 regulation of cell morphogenesis
Gene Ontology
 GO:0022603 regulation of anatomical structure morphogenesis
Gene Ontology
 GO:0016021 integral component of membrane
Gene Ontology
 GO:0016020 membrane
Gene Ontology
 GO:0008360 regulation of cell shape
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0005887 integral component of plasma membrane
Gene Ontology
 GO:0005886 plasma membrane
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005575 cellular_component
Eggnog Protein
 EP:mreD
Eggnog Ortholog
 EO:COG2891
Eggnog Description
 ED:Involved in formation of the rod shape of the cell. May also contribute to regulation of formation of penicillin-binding proteins

Sequences

Nucleotide sequence (GC-content: 27.8 %):

ATGAAGTTTTTCAAGTTTTCTGTTACTCCATATTGGTTGAGTATTATTCCTTTTCTATGGGATGGTCATATTTCGATGCTACTTAACTATTATTTTTCTCCAGAATTATTTCTATCGTCCCACCTCTTTATTATCTATCTATTCATCTTAACTCTCAGCCGTCCTTATAATTGTTCACTTCTATACCTTGTTTGTTTAGGATTTCTATATGATACATATTATTTCAAAACACTCGGTATAGTAATTATAACTCTCCCACTTTTATCCTATCTGTTTTCTCAACTATTGCGTTTTGTCAAGAGAAATGCTTATGTTGATTGTTTACTGGCTTTTTTATTCTTATTTCTCTTTGATACTTTAAATTTTGGTTTTGCCTTATATTATGGCTTAACAAATGAGTATATTAGTGATTTTATTATCTATCAACTCAGTCCTAGTCTAGTGTTTAATCTTTTGATTTTTATTTTGATCAAACCTTTTGTCGAAAAATTATTTTTGTATCTTTTAGTTGATAGATTTAAATAA

Protein sequence:

MKFFKFSVTPYWLSIIPFLWDGHISMLLNYYFSPELFLSSHLFIIYLFILTLSRPYNCSLLYLVCLGFLYDTYYFKTLGIVIITLPLLSYLFSQLLRFVKRNAYVDCLLAFLFLFLFDTLNFGFALYYGLTNEYISDFIIYQLSPSLVFNLLIFILIKPFVEKLFLYLLVDRFK

GenBank Info

gene - mreD
locus_tag - FAM13496-i1-1.1_001503
inference - COORDINATES: similar to AA sequence:RefSeq:WP_002948139.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - rod shape-determining protein MreD
protein_id - extdb:FAM13496-i1-1.1_001503

Gene Locus

Located on scaffold FAM13496-i1-1_scf22

Cellular location expand

Responsible annotations:
SL-0039: GO:0005886 plasma membrane
SL-0162: GO:0016020 membrane
FAM13496-i1-1.1_001502
FAM13496-i1-1.1_001504