update range to 10000 bp
locus tag: FAM13496-i1-1.1_001546 genome: FAM13496-i1-1.1
species: Streptococcus thermophilus taxid: 1308

Annotations

Type Name Description Pathways
Gene Product
 translation initiation factor IF-3
Ortholog
 N0.HOG0001226 translation initiation factor IF-3
KEGG gene
 K02520 infC, MTIF3; translation initiation factor IF-3
Gene Code
 infC
Gene Ontology
 GO:1903008 organelle disassembly
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:1901363 heterocyclic compound binding
Gene Ontology
 GO:0097159 organic cyclic compound binding
Gene Ontology
 GO:0071840 cellular component organization or biogenesis
Gene Ontology
 GO:0071826 ribonucleoprotein complex subunit organization
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0044877 protein-containing complex binding
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
 GO:0044267 -
Gene Ontology
 GO:0044260 cellular macromolecule metabolic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0043933 protein-containing complex organization
Gene Ontology
 GO:0043604 amide biosynthetic process
Gene Ontology
 GO:0043603 cellular amide metabolic process
Gene Ontology
 GO:0043170 macromolecule metabolic process
Gene Ontology
 GO:0043043 peptide biosynthetic process
Gene Ontology
 GO:0043022 ribosome binding
Gene Ontology
 GO:0043021 ribonucleoprotein complex binding
Gene Ontology
 GO:0034645 cellular macromolecule biosynthetic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0032988 ribonucleoprotein complex disassembly
Gene Ontology
 GO:0032984 protein-containing complex disassembly
Gene Ontology
 GO:0032790 ribosome disassembly
Gene Ontology
 GO:0022411 cellular component disassembly
Gene Ontology
 GO:0019538 protein metabolic process
Gene Ontology
 GO:0016043 cellular component organization
Gene Ontology
 GO:0016020 membrane
Gene Ontology
 GO:0010467 gene expression
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009059 macromolecule biosynthetic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0008135 translation factor activity, RNA binding
Gene Ontology
 GO:0006996 organelle organization
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006518 peptide metabolic process
Gene Ontology
 GO:0006413 translational initiation
Gene Ontology
 GO:0006412 translation
Gene Ontology
 GO:0005829 cytosol
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005488 binding
Gene Ontology
 GO:0003743 translation initiation factor activity
Gene Ontology
 GO:0003723 RNA binding
Gene Ontology
 GO:0003676 nucleic acid binding
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:infC
Eggnog Ortholog
 EO:COG0290
Eggnog Description
 ED:IF-3 binds to the 30S ribosomal subunit and shifts the equilibrum between 70S ribosomes and their 50S and 30S subunits in favor of the free subunits

Sequences

Nucleotide sequence (GC-content: 37.9 %):

GTGAAGATCATAGCTAAGAAAGATCTATTTATTAATGATGAAATTCGCGTTCGTGAAGTTCGTCTTGTTGGTCTTGATGGTGAACAATTGGGCATTAAACCATTGTCAGAAGCACAGGCTATTGCAGATGATGCAAATGTTGACCTGGTTCTTATCCAACCACAAGCTACGCCACCTGTTGCGAAGATTATGAACTATGGTAAGTTCAAATTTGAGTATCAAAAGAAACAAAAAGAACAACGTAAGAAACAAAGCGTTGTTACTGTTAAGGAAGTTCGTTTGAGTCCAGTTATCGATAAAGGTGACTTTGAAACAAAACTTCGTAACGGCCGTAAATTCCTTGAAAAGGGAAACAAGGTAAAAGTTTCTATCCGATTCAGAGGCCGTATGATTACTCATAAAGAAATCGGAGCTAAGGTATTGGCGGAATTTGCTGAAAAAACACAAGATATTGCGATCATTGAGCAAAGAGCTAAGATGGATGGACGTCAAATGTTCATGCAACTTGCACCAATTCCTGACAAAAAATAA

Protein sequence:

MKIIAKKDLFINDEIRVREVRLVGLDGEQLGIKPLSEAQAIADDANVDLVLIQPQATPPVAKIMNYGKFKFEYQKKQKEQRKKQSVVTVKEVRLSPVIDKGDFETKLRNGRKFLEKGNKVKVSIRFRGRMITHKEIGAKVLAEFAEKTQDIAIIEQRAKMDGRQMFMQLAPIPDKK

GenBank Info

gene - infC
locus_tag - FAM13496-i1-1.1_001546
inference - COORDINATES: similar to AA sequence:RefSeq:WP_011226065.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - translation initiation factor IF-3
protein_id - extdb:FAM13496-i1-1.1_001546

Gene Locus

Located on scaffold FAM13496-i1-1_scf23

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
SL-0162: GO:0016020 membrane
FAM13496-i1-1.1_001545
FAM13496-i1-1.1_001547