update range to 10000 bp
locus tag: FAM13496-i1-1.1_001576 genome: FAM13496-i1-1.1
species: Streptococcus thermophilus taxid: 1308

Annotations

Type Name Description Pathways
KEGG reaction
 R11636 CTP:formate 2'-oxidoreductase; CTP + Formate <=> dCTP + CO2 + H2O kornec00240kornec01100
KEGG reaction
 R11635 UTP:formate 2'-oxidoreductase; UTP + Formate <=> dUTP + CO2 + H2O kornec00240
KEGG reaction
 R11634 ATP:formate 2'-oxidoreductase; ATP + Formate <=> dATP + CO2 + H2O kornec00230kornec01100
KEGG reaction
 R11633 GTP:formate 2'-oxidoreductase; GTP + Formate <=> dGTP + CO2 + H2O kornec00230kornec01100
KEGG reaction
 R02024 2'-deoxycytidine diphosphate:oxidized-thioredoxin 2'-oxidoreductase; dCDP + Thioredoxin disulfide + H2O <=> Thioredoxin + CDP kornec00240kornec01100
KEGG reaction
 R02019 2'-deoxyguanosine 5'-diphosphate:oxidized-thioredoxin 2'-oxidoreductase; dGDP + Thioredoxin disulfide + H2O <=> GDP + Thioredoxin kornec00230kornec01100
KEGG reaction
 R02018 2'-deoxyuridine 5'-diphosphate:oxidized-thioredoxin 2'-oxidoreductase; dUDP + Thioredoxin disulfide + H2O <=> Thioredoxin + UDP kornec00240kornec01100
KEGG reaction
 R02017 2'-deoxyadenosine 5'-diphosphate:oxidized-thioredoxin 2'-oxidoreductase; dADP + Thioredoxin disulfide + H2O <=> Thioredoxin + ADP kornec00230kornec01100
Ortholog
 N0.HOG0005875 ribonucleotide reductase
KEGG gene
 K21636 nrdD; ribonucleoside-triphosphate reductase (formate) [EC:1.1.98.6] kornec00230kornec00240kornec01100
KEGG gene
 K00525 E1.17.4.1A, nrdA, nrdE; ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1] kornec00230kornec00240kornec01100
Gene Product
 hypothetical protein
Eggnog Protein
 EP:nrdD_1
Eggnog Ortholog
 EO:COG0209
Eggnog Description
 ED:Ribonucleoside-triphosphate reductase
EC Number
 EC:1.1.98.6 ribonucleoside-triphosphate reductase (formate); nrdD (gene name); class III ribonucleoside-triphosphate reductase; anaerobic ribonucleotide reductase; anaerobic ribonucleoside-triphosphate reductase kornec00230kornec00240kornec01100
EC Number
 EC:1.17.4.1 ribonucleoside-diphosphate reductase; ribonucleotide reductase (ambiguous); CDP reductase; ribonucleoside diphosphate reductase; UDP reductase; ADP reductase; nucleoside diphosphate reductase; ribonucleoside 5'-diphosphate reductase; ribonucleotide diphosphate reductase; 2'-deoxyribonucleoside-diphosphate:oxidized-thioredoxin 2'-oxidoreductase; RR; nrdB (gene name); nrdF (gene name); nrdJ (gene name) kornec00230kornec00240kornec00480kornec00983kornec01100

Occurs in the following pathway maps:

Pathway Description
kornec00230 Purine metabolism
kornec00240 Pyrimidine metabolism
kornec00480 Glutathione metabolism
kornec00983 Drug metabolism - other enzymes
kornec01100 Metabolic pathways

Sequences

Nucleotide sequence (GC-content: 37.5 %):

ATGCAAATTATTAAACGTAATGGTCAAGTTGCTGAATTTGATCCTGATAAAATCTACCAAGCCATCTTAAAAGCAGCACAGACTGTGTATGTTCTTGATGATTCTTGGCGACAAAACCTTGCTCAAGTCACTAAAAAAGTAGCACTTGATCTACAAGATGCTCAAGTGGAACGTCCAACCATTAACATGATTCAATCATTGGTTGAAAATCGTCTTATGGAAGCTGGTTTCATCAATATCGCCGAGCATTATATTTCATACCGTTTACAACGAGATTTGGAGCGTAACGGTTATGGTGACAAAGTAATCGTACACCTACGCTTTGAACAGACTAAATAA

Protein sequence:

MQIIKRNGQVAEFDPDKIYQAILKAAQTVYVLDDSWRQNLAQVTKKVALDLQDAQVERPTINMIQSLVENRLMEAGFINIAEHYISYRLQRDLERNGYGDKVIVHLRFEQTK

GenBank Info

locus_tag - FAM13496-i1-1.1_001576
inference - COORDINATES: similar to AA sequence:RefSeq:WP_018365984.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - hypothetical protein
protein_id - extdb:FAM13496-i1-1.1_001576

Gene Locus

Located on scaffold FAM13496-i1-1_scf24

FAM13496-i1-1.1_001575
FAM13496-i1-1.1_001577