update range to 10000 bp
locus tag: FAM19038-p1-1.1_001754 genome: FAM19038-p1-1.1
species: Acidipropionibacterium jensenii taxid: 1749

Annotations

Type Name Description Pathways
Ortholog
 N0.HOG0003265 integration host factor
KEGG gene
 K03530 hupB; DNA-binding protein HU-beta
Gene Product
 integration host factor
Gene Ontology
 GO:2001141 regulation of RNA biosynthetic process
Gene Ontology
 GO:1903506 regulation of nucleic acid-templated transcription
Gene Ontology
 GO:1901363 heterocyclic compound binding
Gene Ontology
 GO:0097159 organic cyclic compound binding
Gene Ontology
 GO:0080090 regulation of primary metabolic process
Gene Ontology
 GO:0065007 biological regulation
Gene Ontology
 GO:0060255 regulation of macromolecule metabolic process
Gene Ontology
 GO:0051252 regulation of RNA metabolic process
Gene Ontology
 GO:0051171 regulation of nitrogen compound metabolic process
Gene Ontology
 GO:0050794 regulation of cellular process
Gene Ontology
 GO:0050789 regulation of biological process
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0031326 regulation of cellular biosynthetic process
Gene Ontology
 GO:0031323 regulation of cellular metabolic process
Gene Ontology
 GO:0019222 regulation of metabolic process
Gene Ontology
 GO:0019219 regulation of nucleobase-containing compound metabolic process
Gene Ontology
 GO:0010556 regulation of macromolecule biosynthetic process
Gene Ontology
 GO:0009889 regulation of biosynthetic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0005829 cytosol
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005488 binding
Gene Ontology
 GO:0003677 DNA binding
Gene Ontology
 GO:0003676 nucleic acid binding
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:hup
Eggnog Ortholog
 EO:COG0776
Eggnog Description
 ED:Belongs to the bacterial histone-like protein family

Sequences

Nucleotide sequence (GC-content: 65.6 %):

ATGACCAAGTCCGAGCTCATCAAGGCCATCGCCAAGGAGGCCTCGCTCACCGAGACCCAGGCCAACGAAGCTGTCAAGGCGCTCACCGACGTCATCACCACCGCCCTGGTGAACGGCGAGAAGGTTCAGCTTCCCGGTCTGCTCACCGCCGAGTCGGTCGAGCGTCCGGCGCGCAACGGGCGCAACCCGCGCACCGGCGAGTCGATGACCATCCCGGCCCACAAGGCCGTCAAGATCTCGGCATCGAGCACCCTCAAGAAGGCCGTCTCGGAGTGA

Protein sequence:

MTKSELIKAIAKEASLTETQANEAVKALTDVITTALVNGEKVQLPGLLTAESVERPARNGRNPRTGESMTIPAHKAVKISASSTLKKAVSE

GenBank Info

locus_tag - FAM19038-p1-1.1_001754
inference - COORDINATES: similar to AA sequence:RefSeq:WP_002549218.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - integration host factor
protein_id - extdb:FAM19038-p1-1.1_001754

Gene Locus

Located on scaffold FAM19038-p1-1_scf1

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
FAM19038-p1-1.1_001753
FAM19038-p1-1.1_001755