update range to 10000 bp
locus tag: FAM19038-p1-1.1_001764 genome: FAM19038-p1-1.1
species: Acidipropionibacterium jensenii taxid: 1749

Annotations

Type Name Description Pathways
Gene Product
 thymidylate synthase
KEGG reaction
 R02101 5,10-Methylenetetrahydrofolate:dUMP C-methyltransferase; dUMP + 5,10-Methylenetetrahydrofolate <=> Dihydrofolate + dTMP kornec00240kornec00670kornec01100
Ortholog
 N0.HOG0001216 thymidylate synthase
KEGG gene
 K00560 thyA, TYMS; thymidylate synthase [EC:2.1.1.45] kornec00240kornec00670kornec01100kornec01523
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901575 organic substance catabolic process
Gene Ontology
 GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
 GO:1901565 organonitrogen compound catabolic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:1901362 organic cyclic compound biosynthetic process
Gene Ontology
 GO:1901361 organic cyclic compound catabolic process
Gene Ontology
 GO:1901360 organic cyclic compound metabolic process
Gene Ontology
 GO:1901293 nucleoside phosphate biosynthetic process
Gene Ontology
 GO:1901292 nucleoside phosphate catabolic process
Gene Ontology
 GO:1901137 carbohydrate derivative biosynthetic process
Gene Ontology
 GO:1901136 carbohydrate derivative catabolic process
Gene Ontology
 GO:1901135 carbohydrate derivative metabolic process
Gene Ontology
 GO:0090407 organophosphate biosynthetic process
Gene Ontology
 GO:0072529 pyrimidine-containing compound catabolic process
Gene Ontology
 GO:0072528 pyrimidine-containing compound biosynthetic process
Gene Ontology
 GO:0072527 pyrimidine-containing compound metabolic process
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0055086 nucleobase-containing small molecule metabolic process
Gene Ontology
 GO:0046700 heterocycle catabolic process
Gene Ontology
 GO:0046483 heterocycle metabolic process
Gene Ontology
 GO:0046434 organophosphate catabolic process
Gene Ontology
 GO:0046386 deoxyribose phosphate catabolic process
Gene Ontology
 GO:0046385 deoxyribose phosphate biosynthetic process
Gene Ontology
 GO:0046079 dUMP catabolic process
Gene Ontology
 GO:0046078 dUMP metabolic process
Gene Ontology
 GO:0046073 dTMP metabolic process
Gene Ontology
 GO:0044283 small molecule biosynthetic process
Gene Ontology
 GO:0044281 small molecule metabolic process
Gene Ontology
 GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
 GO:0044270 cellular nitrogen compound catabolic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044248 cellular catabolic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0042083 5,10-methylenetetrahydrofolate-dependent methyltransferase activity
Gene Ontology
 GO:0034655 nucleobase-containing compound catabolic process
Gene Ontology
 GO:0034654 nucleobase-containing compound biosynthetic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0034404 nucleobase-containing small molecule biosynthetic process
Gene Ontology
 GO:0032259 methylation
Gene Ontology
 GO:0019692 deoxyribose phosphate metabolic process
Gene Ontology
 GO:0019637 organophosphate metabolic process
Gene Ontology
 GO:0019439 aromatic compound catabolic process
Gene Ontology
 GO:0019438 aromatic compound biosynthetic process
Gene Ontology
 GO:0018130 heterocycle biosynthetic process
Gene Ontology
 GO:0016741 transferase activity, transferring one-carbon groups
Gene Ontology
 GO:0016740 transferase activity
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009394 2'-deoxyribonucleotide metabolic process
Gene Ontology
 GO:0009265 2'-deoxyribonucleotide biosynthetic process
Gene Ontology
 GO:0009264 deoxyribonucleotide catabolic process
Gene Ontology
 GO:0009263 deoxyribonucleotide biosynthetic process
Gene Ontology
 GO:0009262 deoxyribonucleotide metabolic process
Gene Ontology
 GO:0009223 pyrimidine deoxyribonucleotide catabolic process
Gene Ontology
 GO:0009221 pyrimidine deoxyribonucleotide biosynthetic process
Gene Ontology
 GO:0009219 pyrimidine deoxyribonucleotide metabolic process
Gene Ontology
 GO:0009178 pyrimidine deoxyribonucleoside monophosphate catabolic process
Gene Ontology
 GO:0009177 pyrimidine deoxyribonucleoside monophosphate biosynthetic process
Gene Ontology
 GO:0009176 pyrimidine deoxyribonucleoside monophosphate metabolic process
Gene Ontology
 GO:0009166 nucleotide catabolic process
Gene Ontology
 GO:0009165 nucleotide biosynthetic process
Gene Ontology
 GO:0009162 deoxyribonucleoside monophosphate metabolic process
Gene Ontology
 GO:0009159 deoxyribonucleoside monophosphate catabolic process
Gene Ontology
 GO:0009157 deoxyribonucleoside monophosphate biosynthetic process
Gene Ontology
 GO:0009131 pyrimidine nucleoside monophosphate catabolic process
Gene Ontology
 GO:0009130 pyrimidine nucleoside monophosphate biosynthetic process
Gene Ontology
 GO:0009129 pyrimidine nucleoside monophosphate metabolic process
Gene Ontology
 GO:0009125 nucleoside monophosphate catabolic process
Gene Ontology
 GO:0009124 nucleoside monophosphate biosynthetic process
Gene Ontology
 GO:0009123 nucleoside monophosphate metabolic process
Gene Ontology
 GO:0009117 nucleotide metabolic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0009056 catabolic process
Gene Ontology
 GO:0008168 methyltransferase activity
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006796 phosphate-containing compound metabolic process
Gene Ontology
 GO:0006793 phosphorus metabolic process
Gene Ontology
 GO:0006753 nucleoside phosphate metabolic process
Gene Ontology
 GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
 GO:0006244 pyrimidine nucleotide catabolic process
Gene Ontology
 GO:0006231 dTMP biosynthetic process
Gene Ontology
 GO:0006221 pyrimidine nucleotide biosynthetic process
Gene Ontology
 GO:0006220 pyrimidine nucleotide metabolic process
Gene Ontology
 GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
 GO:0004799 thymidylate synthase activity
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:thyA
Eggnog Ortholog
 EO:COG0207
Eggnog Description
 ED:Catalyzes the reductive methylation of 2'-deoxyuridine- 5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5
EC Number
 EC:2.1.1.45 thymidylate synthase; dTMP synthase; thymidylate synthetase; methylenetetrahydrofolate:dUMP C-methyltransferase; TMP synthetase kornec00240kornec00670kornec01100

Occurs in the following pathway maps:

Pathway Description
kornec00240 Pyrimidine metabolism
kornec00670 One carbon pool by folate
kornec01100 Metabolic pathways
kornec01523 Antifolate resistance

Sequences

Nucleotide sequence (GC-content: 67.2 %):

ATGCAGCAGTACCTCGACCTGCTGCGCCGGATCCTCACCGAGGGGTCCCGCCGCCAGGACCGCACCGGCACCGGGACGCTGAGCGTCTTCGGACACCAGATGCGCTTCGACCTGCGCCAGGGATTCCCACTGGTCACCACCAAGAGGATCTACACCCGGGCGGTCTTCGGGGAGCTGCTGTGGTTCCTGCGGGGGGACACCAATGTCTCCTGGCTCCACGACAACAACATCCACATCTGGGACGAGTGGGCCGACGAGAAGGGCGAGCTGGGGCCGATCTACGGCCACCAGTGGCGGTCCTGGCCCGATCTTCACGGGGGCAGCATCGACCAGATCGCCCGGGTCATCGAGCAGATCCGCACCGACCCCTGGTCGCGGCGTCACATCGTCAGCGCCTGGAACCCGGCCGAGGTCGACGAGATGGCACTGCCGCCCTGCCACACGATGTTCCAGTTCTACGTGACCGGCGACGACTCCGGGAGGCCTGCCTGGCTGTCCTGTCAGCTCTACCAGCGCAGCGGTGACACCTTCCTGGGGGTGCCCTTCAACATCGCCTCCTACGCCCTGCTGACCCACCTGGTCGCCCGGCTCACCGGGCTGCGACCCCTGGAGTTCGTCCACACCCTCGGCGACGCCCACCTCTACCTCAACCATCTCGACCAGGTCCACGAGCAGCTGGGCAGGACCCCCAGGGCGCTGCCCCGGCTGGTGCTCAGTCCCGACATCTCATCCATCGACGCGGTGGAGCTGTCCGACATCAGCATCGAGGGATACGACCCCTACCCGGCCATCAAGGCCCCGATCGCGGTCTGA

Protein sequence:

MQQYLDLLRRILTEGSRRQDRTGTGTLSVFGHQMRFDLRQGFPLVTTKRIYTRAVFGELLWFLRGDTNVSWLHDNNIHIWDEWADEKGELGPIYGHQWRSWPDLHGGSIDQIARVIEQIRTDPWSRRHIVSAWNPAEVDEMALPPCHTMFQFYVTGDDSGRPAWLSCQLYQRSGDTFLGVPFNIASYALLTHLVARLTGLRPLEFVHTLGDAHLYLNHLDQVHEQLGRTPRALPRLVLSPDISSIDAVELSDISIEGYDPYPAIKAPIAV

GenBank Info

locus_tag - FAM19038-p1-1.1_001764
EC_number - 2.1.1.45
inference - COORDINATES: similar to AA sequence:RefSeq:WP_002516154.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - thymidylate synthase
protein_id - extdb:FAM19038-p1-1.1_001764

Gene Locus

Located on scaffold FAM19038-p1-1_scf1

FAM19038-p1-1.1_001763
FAM19038-p1-1.1_001765