update range to 10000 bp
locus tag: FAM19038-p1-1.1_001861 genome: FAM19038-p1-1.1
species: Acidipropionibacterium jensenii taxid: 1749

Annotations

Type Name Description Pathways
Ortholog
 N0.HOG0000502 ATP-dependent Clp protease proteolytic subunit
KEGG gene
 K01358 clpP, CLPP; ATP-dependent Clp protease, protease subunit [EC:3.4.21.92] kornec04112kornec04212
Gene Ontology
 GO:0071944 cell periphery
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0040007 growth
Gene Ontology
 GO:0030312 external encapsulating structure
Gene Ontology
 GO:0016020 membrane
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0005886 plasma membrane
Gene Ontology
 GO:0005829 cytosol
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005618 cell wall
Gene Ontology
 GO:0005575 cellular_component
Eggnog Protein
 EP:clpP
Eggnog Ortholog
 EO:COG0740
Eggnog Description
 ED:Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins
EC Number
 EC:3.4.21.92 endopeptidase Clp; endopeptidase Ti; caseinolytic protease; protease Ti; ATP-dependent Clp protease; ClpP; Clp protease
Gene Product
 ATP-dependent Clp protease proteolytic subunit

Occurs in the following pathway maps:

Pathway Description
kornec04112 Cell cycle - Caulobacter
kornec04212 Longevity regulating pathway - worm

Sequences

Nucleotide sequence (GC-content: 66.0 %):

ATGGATCTTTCCACGATGGCCGGATTCAACGCCCAGCAGGCCGCCCACGCGCTGGCCGGCGCCGGCGTCTCCCCGGTCTCACCCGTGATGCCCTCGACGATGCCCTCGTCGACGAGCAGCCAGCCCGCACCCTCGATGGACTACTACATCCCCCAGTGGGAGGAGCGCACCTCCTACGGGGTGCGGCGGGTCGACCCCTACACCAAGCTCTTCGAGGACCGGATCATCTTCCTCGGCACCCCGGTCACCGACGACATCGCCAATGCCGTGATGGCCCAGCTGCTGTGCCTGCAGTCGATGGACCCGGACCGCCAGATCAGCATGTACATCAACTCGCCCGGCGGCTCCTTCTCCGCGATGAGCGCCATCTACGACACGATGAACTACGTGCGCCCCGACATCCAGACGATCTGCCTGGGAATGGCGGCCTCGGCGGCGGCGGTCCTGCTCGCCGCCGGCACCAAGGGCAAGCGGTTGGCCCTGCCGAACTCGACGATCCTCATCCACCAGCCCGCGATGGGCCAGTCGAGCTACGGTCAGTCCTCCGACATCGAGATCCAGGCCAACGAGATCCAGCGGATCCGCAGGCTGATGGAGAAGATGCTCTCGGAGGCCACCGGCCAGACCGAGGAGCAGGTCTCCCAGGATGTCGACCGTGACAAGTACCTCACCGCCGAGGGAGCCAAGGAGTACGGCCTCATCGACGACATCCTCACCTCGGTGTGA

Protein sequence:

MDLSTMAGFNAQQAAHALAGAGVSPVSPVMPSTMPSSTSSQPAPSMDYYIPQWEERTSYGVRRVDPYTKLFEDRIIFLGTPVTDDIANAVMAQLLCLQSMDPDRQISMYINSPGGSFSAMSAIYDTMNYVRPDIQTICLGMAASAAAVLLAAGTKGKRLALPNSTILIHQPAMGQSSYGQSSDIEIQANEIQRIRRLMEKMLSEATGQTEEQVSQDVDRDKYLTAEGAKEYGLIDDILTSV

GenBank Info

locus_tag - FAM19038-p1-1.1_001861
inference - COORDINATES: similar to AA sequence:RefSeq:WP_016665810.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - ATP-dependent Clp protease proteolytic subunit
protein_id - extdb:FAM19038-p1-1.1_001861

Gene Locus

Located on scaffold FAM19038-p1-1_scf1

Cellular location expand

Responsible annotations:
SL-0041: GO:0005618 cell wall
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
SL-0039: GO:0005886 plasma membrane
SL-0162: GO:0016020 membrane
FAM19038-p1-1.1_001860
FAM19038-p1-1.1_001862