update range to 10000 bp
locus tag: FAM19038-p1-1.1_002231 genome: FAM19038-p1-1.1
species: Acidipropionibacterium jensenii taxid: 1749

Annotations

Type Name Description Pathways
Gene Product
 RNA polymerase-binding protein RbpA
Ortholog
 N0.HOG0002285 RNA polymerase-binding protein RbpA
Gene Ontology
 GO:2001141 regulation of RNA biosynthetic process
Gene Ontology
 GO:2000112 regulation of cellular macromolecule biosynthetic process
Gene Ontology
 GO:1903508 positive regulation of nucleic acid-templated transcription
Gene Ontology
 GO:1903506 regulation of nucleic acid-templated transcription
Gene Ontology
 GO:1902680 positive regulation of RNA biosynthetic process
Gene Ontology
 GO:0080090 regulation of primary metabolic process
Gene Ontology
 GO:0070063 RNA polymerase binding
Gene Ontology
 GO:0065007 biological regulation
Gene Ontology
 GO:0060255 regulation of macromolecule metabolic process
Gene Ontology
 GO:0051254 positive regulation of RNA metabolic process
Gene Ontology
 GO:0051252 regulation of RNA metabolic process
Gene Ontology
 GO:0051173 positive regulation of nitrogen compound metabolic process
Gene Ontology
 GO:0051171 regulation of nitrogen compound metabolic process
Gene Ontology
 GO:0050896 response to stimulus
Gene Ontology
 GO:0050794 regulation of cellular process
Gene Ontology
 GO:0050789 regulation of biological process
Gene Ontology
 GO:0048522 positive regulation of cellular process
Gene Ontology
 GO:0048518 positive regulation of biological process
Gene Ontology
 GO:0046914 transition metal ion binding
Gene Ontology
 GO:0046872 metal ion binding
Gene Ontology
 GO:0046677 response to antibiotic
Gene Ontology
 GO:0045935 positive regulation of nucleobase-containing compound metabolic process
Gene Ontology
 GO:0045893 positive regulation of DNA-templated transcription
Gene Ontology
 GO:0043175 RNA polymerase core enzyme binding
Gene Ontology
 GO:0043169 cation binding
Gene Ontology
 GO:0043167 ion binding
Gene Ontology
 GO:0042221 response to chemical
Gene Ontology
 GO:0031328 positive regulation of cellular biosynthetic process
Gene Ontology
 GO:0031326 regulation of cellular biosynthetic process
Gene Ontology
 GO:0031325 positive regulation of cellular metabolic process
Gene Ontology
 GO:0031323 regulation of cellular metabolic process
Gene Ontology
 GO:0019899 enzyme binding
Gene Ontology
 GO:0019222 regulation of metabolic process
Gene Ontology
 GO:0019219 regulation of nucleobase-containing compound metabolic process
Gene Ontology
 GO:0010628 positive regulation of gene expression
Gene Ontology
 GO:0010604 positive regulation of macromolecule metabolic process
Gene Ontology
 GO:0010557 positive regulation of macromolecule biosynthetic process
Gene Ontology
 GO:0010556 regulation of macromolecule biosynthetic process
Gene Ontology
 GO:0010468 regulation of gene expression
Gene Ontology
 GO:0009893 positive regulation of metabolic process
Gene Ontology
 GO:0009891 positive regulation of biosynthetic process
Gene Ontology
 GO:0009889 regulation of biosynthetic process
Gene Ontology
 GO:0008270 zinc ion binding
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006355 regulation of DNA-templated transcription
Gene Ontology
 GO:0005515 protein binding
Gene Ontology
 GO:0005488 binding
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0001108 bacterial-type RNA polymerase holo enzyme binding
Gene Ontology
 GO:0001098 basal transcription machinery binding
Gene Ontology
 GO:0001000 bacterial-type RNA polymerase core enzyme binding
Eggnog Protein
 EP:rbpA
Eggnog Ortholog
 EO:2CNY9
Eggnog Description
 ED:Binds to RNA polymerase (RNAP)

Sequences

Nucleotide sequence (GC-content: 62.1 %):

ATGGCAGATCGTGCACTGCGTGGCATGGGTCTGGGGTCCAAGAGTTTCGAGGACGAGGAAGGCGTCGAGATGGCCGAGAGGCAGGAGATCGGTTTCGACTGCCCCAACGGCCATCACTTCGAGATCACCTTCTCGGTCGAGGCTGAACTCCCCGGAGTCTGGGAGTGCCCGCGATGTGGCGCCGAGTCACACCGAAGCGACGGGACGAAAGCCGAGAAGAAGAAGGAGAAGCCCCAGCGCACCCACTGGGACATGCTGACCGAGCGCCGTTCCATCCCCGAGTTGGAGGAACTGCTCAAGGAGAGGCTCGAGGAGATCCGCAAGGAGTGA

Protein sequence:

MADRALRGMGLGSKSFEDEEGVEMAERQEIGFDCPNGHHFEITFSVEAELPGVWECPRCGAESHRSDGTKAEKKKEKPQRTHWDMLTERRSIPELEELLKERLEEIRKE

GenBank Info

locus_tag - FAM19038-p1-1.1_002231
inference - COORDINATES: similar to AA sequence:RefSeq:WP_002546879.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - RNA polymerase-binding protein RbpA
protein_id - extdb:FAM19038-p1-1.1_002231

Gene Locus

Located on scaffold FAM19038-p1-1_scf1

FAM19038-p1-1.1_002230
FAM19038-p1-1.1_002232