update range to 10000 bp
locus tag: FAM19038-p1-1.1_002300 genome: FAM19038-p1-1.1
species: Acidipropionibacterium jensenii taxid: 1749

Annotations

Type Name Description Pathways
Gene Product
 proteasome subunit alpha
Gene Code
 prcA
Ortholog
 N0.HOG0002288 proteasome subunit alpha
KEGG gene
 K03432 psmA, prcA; proteasome alpha subunit [EC:3.4.25.1] kornec03050
Gene Ontology
 GO:1905369 endopeptidase complex
Gene Ontology
 GO:1905368 peptidase complex
Gene Ontology
 GO:1902494 catalytic complex
Gene Ontology
 GO:1901575 organic substance catabolic process
Gene Ontology
 GO:1901565 organonitrogen compound catabolic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:0140096 catalytic activity, acting on a protein
Gene Ontology
 GO:0071944 cell periphery
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0070011 -
Gene Ontology
 GO:0070003 threonine-type peptidase activity
Gene Ontology
 GO:0051704 obsolete multi-organism process
Gene Ontology
 GO:0051603 proteolysis involved in protein catabolic process
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044419 biological process involved in interspecies interaction between organisms
Gene Ontology
 GO:0044267 -
Gene Ontology
 GO:0044265 cellular macromolecule catabolic process
Gene Ontology
 GO:0044260 cellular macromolecule metabolic process
Gene Ontology
 GO:0044257 -
Gene Ontology
 GO:0044248 cellular catabolic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0043632 modification-dependent macromolecule catabolic process
Gene Ontology
 GO:0043170 macromolecule metabolic process
Gene Ontology
 GO:0040007 growth
Gene Ontology
 GO:0032991 protein-containing complex
Gene Ontology
 GO:0030312 external encapsulating structure
Gene Ontology
 GO:0030163 protein catabolic process
Gene Ontology
 GO:0019941 modification-dependent protein catabolic process
Gene Ontology
 GO:0019773 proteasome core complex, alpha-subunit complex
Gene Ontology
 GO:0019538 protein metabolic process
Gene Ontology
 GO:0016787 hydrolase activity
Gene Ontology
 GO:0016020 membrane
Gene Ontology
 GO:0010498 proteasomal protein catabolic process
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009405 obsolete pathogenesis
Gene Ontology
 GO:0009057 macromolecule catabolic process
Gene Ontology
 GO:0009056 catabolic process
Gene Ontology
 GO:0008233 peptidase activity
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006508 proteolysis
Gene Ontology
 GO:0005886 plasma membrane
Gene Ontology
 GO:0005839 proteasome core complex
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005618 cell wall
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0004298 threonine-type endopeptidase activity
Gene Ontology
 GO:0004175 endopeptidase activity
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0000502 proteasome complex
Eggnog Protein
 EP:prcA
Eggnog Ortholog
 EO:COG0638
Eggnog Description
 ED:Component of the proteasome core
EC Number
 EC:3.4.25.1 proteasome endopeptidase complex; ingensin; macropain; multicatalytic endopeptidase complex; prosome; multicatalytic proteinase (complex); MCP; proteasome; large multicatalytic protease; multicatalytic proteinase; proteasome organelle; alkaline protease; 26S protease; tricorn proteinase; tricorn protease

Occurs in the following pathway maps:

Pathway Description
kornec03050 Proteasome

Sequences

Nucleotide sequence (GC-content: 69.6 %):

ATGACCATGCCCGCATACGTCTCACCCGACCAGTGGATGAGCGACAGGGCGGACTATGCCCGGCGCGGGGTGTCTCGCGGCCGGGCGGTGGTGGTGGCCCGCTGCGCCGACGGGATCTGCATGGTGGCCCTCAACTCATCGAGGTCCCTGCGCAAGACCTCCGAGATCCATGACCGGATCGGATTCGCTGCGGTCGGTCGCTACGACGAGTTGGAGCAGCTGCGGGTGGCCGGGATCCGACTGGCCGACATCCGTGCCTACGCCTACGACCGCCTCGACGTCACCGGCCTGGCGCTGGCCACCACCTACGCCCAGGTGATCGGCGCGAACTTCGCGACGCTGTCCCAGAAGCCCTACGAGGTGGAACTGGCGGTCGCCGAACTGGGACTCAGCCGCGCCGAGGACAGGATCTTCAAGATCTCCTGGGACGGCTCGGTCGCTGACGGCAGTGCCCCGACGGTGCTGGGACCGATGGCCCAGGACCGCCGCGACACCCTCAACGAGTTCCTCACCGACTCCACCCCCCTCGACGACGCCGTGCGGTGCGCCGCCGCGGCGCTCACCGCCTCCTCCGAACCGACCCCCGAGCAGCTGGAGGTCTCGATCCTCGATCCACGCACCGGCGGCCGCCGAACCTTCCGCCGGCTCAGCGCCGAGCGGATCCGATCCTTCTGGGGTGCCAGGTGA

Protein sequence:

MTMPAYVSPDQWMSDRADYARRGVSRGRAVVVARCADGICMVALNSSRSLRKTSEIHDRIGFAAVGRYDELEQLRVAGIRLADIRAYAYDRLDVTGLALATTYAQVIGANFATLSQKPYEVELAVAELGLSRAEDRIFKISWDGSVADGSAPTVLGPMAQDRRDTLNEFLTDSTPLDDAVRCAAAALTASSEPTPEQLEVSILDPRTGGRRTFRRLSAERIRSFWGAR

GenBank Info

gene - prcA
locus_tag - FAM19038-p1-1.1_002300
EC_number - 3.4.25.1
inference - COORDINATES: similar to AA sequence:RefSeq:WP_015070458.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - proteasome subunit alpha
protein_id - extdb:FAM19038-p1-1.1_002300

Gene Locus

Located on scaffold FAM19038-p1-1_scf1

Cellular location expand

Responsible annotations:
SL-0041: GO:0005618 cell wall
SL-0229: GO:0005622 intracellular anatomical structure
SL-0039: GO:0005886 plasma membrane
SL-0162: GO:0016020 membrane
FAM19038-p1-1.1_002299
FAM19038-p1-1.1_002301