update range to 10000 bp
locus tag: FAM19038-p1-1.1_002315 genome: FAM19038-p1-1.1
species: Acidipropionibacterium jensenii taxid: 1749

Annotations

Type Name Description Pathways
KEGG reaction
 R00443 UTP:RNA uridylyltransferase; UTP + RNA <=> Diphosphate + RNA
KEGG reaction
 R00442 CTP:RNA cytidylyltransferase (DNA-directed); CTP:RNA cytidylyltransferase (RNA-directed); CTP + RNA <=> Diphosphate + RNA
KEGG reaction
 R00441 GTP:RNA guanylyltransferase (DNA-directed); GTP:RNA guanylyltransferase (RNA-directed); GTP + RNA <=> Diphosphate + RNA
KEGG reaction
 R00435 ATP:polynucleotide adenylyltransferase; ATP:RNA adenylyltransferase; ATP + RNA <=> Diphosphate + RNA
Ortholog
 N0.HOG0001237 DNA-directed RNA polymerase subunit omega
KEGG gene
 K03060 rpoZ; DNA-directed RNA polymerase subunit omega [EC:2.7.7.6] kornec03020
Gene Ontology
 GO:0071944 cell periphery
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0040007 growth
Gene Ontology
 GO:0030312 external encapsulating structure
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005618 cell wall
Gene Ontology
 GO:0005575 cellular_component
Eggnog Protein
 EP:rpoZ
Eggnog Ortholog
 EO:COG1758
Eggnog Description
 ED:Promotes RNA polymerase assembly. Latches the N- and C- terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits
EC Number
 EC:2.7.7.6 DNA-directed RNA polymerase; RNA polymerase; RNA nucleotidyltransferase (DNA-directed); RNA polymerase I; RNA polymerase II; RNA polymerase III; C RNA formation factors; deoxyribonucleic acid-dependent ribonucleic acid polymerase; DNA-dependent ribonucleate nucleotidyltransferase; DNA-dependent RNA nucleotidyltransferase; DNA-dependent RNA polymerase; ribonucleate nucleotidyltransferase; ribonucleate polymerase; C ribonucleic acid formation factors; ribonucleic acid nucleotidyltransferase; ribonucleic acid polymerase; ribonucleic acid transcriptase; ribonucleic polymerase; ribonucleic transcriptase; RNA nucleotidyltransferase; RNA transcriptase; transcriptase; RNA nucleotidyltransferase I
Gene Product
 DNA-directed RNA polymerase subunit omega

Occurs in the following pathway maps:

Pathway Description
kornec03020 RNA polymerase

Sequences

Nucleotide sequence (GC-content: 67.5 %):

TTGAGCGAGACCATCCCCGAGGGCATCGTCAACCCCCCGATCGATCAGCTTCTTGAGCACGTCGACTCCAAGTACCGGCTGGTGCTGTTCGCCGCCAAGCGCGCCCGTCAGATCAACGCCTACTACTCGCAGCTGGCCGAGGGCCTGCTGGAGAACGTCGGTCCCCTCGTCGAGGTCTCCAACCAGGAGAAGCCGCTGTCCATCGCGCTGCGCGAGATTCAGGCCGGGGTCATCGAGGCTCATCAGATGAACCCCGAGGAGGTCGCGGCCGAGGCCGCCGCCGCACAGCAGGCGCCCGCCGTCGAGCTCGACGACCCGTTCGCCGACCTCACCCCTCCGGCCTGA

Protein sequence:

MSETIPEGIVNPPIDQLLEHVDSKYRLVLFAAKRARQINAYYSQLAEGLLENVGPLVEVSNQEKPLSIALREIQAGVIEAHQMNPEEVAAEAAAAQQAPAVELDDPFADLTPPA

GenBank Info

locus_tag - FAM19038-p1-1.1_002315
EC_number - 2.7.7.6
inference - COORDINATES: similar to AA sequence:RefSeq:WP_015070476.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - DNA-directed RNA polymerase subunit omega
protein_id - extdb:FAM19038-p1-1.1_002315

Gene Locus

Located on scaffold FAM19038-p1-1_scf1

Cellular location expand

Responsible annotations:
SL-0041: GO:0005618 cell wall
FAM19038-p1-1.1_002314
FAM19038-p1-1.1_002316