update range to 10000 bp
locus tag: FAM19038-p1-1.1_002377 genome: FAM19038-p1-1.1
species: Acidipropionibacterium jensenii taxid: 1749

Annotations

Type Name Description Pathways
KEGG reaction
 R04212 Asp-tRNA(Asn):L-glutamine amido-ligase (ADP-forming); L-Asparaginyl-tRNA(Asn) + L-Glutamate + Orthophosphate + ADP <=> L-Aspartyl-tRNA(Asn) + L-Glutamine + ATP + H2O kornec00970
KEGG reaction
 R03905 Glu-tRNA(Gln):L-glutamine amido-ligase(ADP-forming); Glutaminyl-tRNA + L-Glutamate + Orthophosphate + ADP <=> L-Glutamyl-tRNA(Gln) + L-Glutamine + ATP + H2O kornec00970kornec01100
Ortholog
 N0.HOG0001312 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC
KEGG gene
 K02435 gatC, GATC; aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7] kornec00970kornec01100
Gene Ontology
 GO:0071944 cell periphery
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0030312 external encapsulating structure
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005618 cell wall
Gene Ontology
 GO:0005575 cellular_component
Gene Code
 gatC
Eggnog Protein
 EP:gatC
Eggnog Ortholog
 EO:COG0721
Eggnog Description
 ED:Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp- tRNA(Asn) or Glu-tRNA(Gln) in organisms which lack either or both of asparaginyl-tRNA or glutaminyl-tRNA synthetases. The reaction takes place in the presence of glutamine and ATP through an activated phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA(Gln)
EC Number
 EC:6.3.5.7 glutaminyl-tRNA synthase (glutamine-hydrolysing); Glu-AdT; Glu-tRNAGln amidotransferase; glutamyl-tRNAGln amidotransferase; Glu-tRNAGln:L-glutamine amido-ligase (ADP-forming); GatCAB; GatFAB; GatDE kornec00970kornec01100
EC Number
 EC:6.3.5.6 asparaginyl-tRNA synthase (glutamine-hydrolysing); Asp-AdT; Asp-tRNAAsn amidotransferase; aspartyl-tRNAAsn amidotransferase; Asn-tRNAAsn:L-glutamine amido-ligase (ADP-forming); aspartyl-tRNAAsn:L-glutamine amido-ligase (ADP-forming); GatCAB kornec00970
Gene Product
 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC

Occurs in the following pathway maps:

Pathway Description
kornec00970 Aminoacyl-tRNA biosynthesis
kornec01100 Metabolic pathways

Sequences

Nucleotide sequence (GC-content: 66.4 %):

ATGTTCTCTGCCCCGTCCCCCAGGAGGATCATCGTGGCTCTCACGCCGGATGACGTCACCCGTCTGGCCGGCCTGGCACGTATTGAGCTGACCGCCGATGAGACCGCCACGCTGGCACCCCAGCTTGAGGTCATTCTCGACGCCGTCGCCAGCGTGTCGAAGGTTGCCACCGCCGAGGTGCCGCCCACCTCTCACGCACTGCCCTTGGTCAATGCCTTCCGACCGGATGAGGTGAAACCCTCGATGCCGGCCGAGGAGGCGCTGGCGATGGCTCCGCGCGCCGAGCAGAACCGGTTCAGGGTGCCGAGGATTCTCGACCAGGAGGCCCAAGGATGA

Protein sequence:

MFSAPSPRRIIVALTPDDVTRLAGLARIELTADETATLAPQLEVILDAVASVSKVATAEVPPTSHALPLVNAFRPDEVKPSMPAEEALAMAPRAEQNRFRVPRILDQEAQG

GenBank Info

gene - gatC
locus_tag - FAM19038-p1-1.1_002377
inference - COORDINATES: similar to AA sequence:RefSeq:WP_002520513.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC
protein_id - extdb:FAM19038-p1-1.1_002377

Gene Locus

Located on scaffold FAM19038-p1-1_scf1

Cellular location expand

Responsible annotations:
SL-0041: GO:0005618 cell wall
FAM19038-p1-1.1_002376
FAM19038-p1-1.1_002378