update range to 10000 bp
locus tag: FAM19038-p1-1.1_002520 genome: FAM19038-p1-1.1
species: Acidipropionibacterium jensenii taxid: 1749

Annotations

Type Name Description Pathways
Gene Product
 transcriptional repressor
Ortholog
 N0.HOG0000830 transcriptional repressor
KEGG gene
 K03711 fur, zur, furB; Fur family transcriptional regulator, ferric uptake regulator
Gene Ontology
 GO:2001141 regulation of RNA biosynthetic process
Gene Ontology
 GO:2000113 negative regulation of cellular macromolecule biosynthetic process
Gene Ontology
 GO:2000112 regulation of cellular macromolecule biosynthetic process
Gene Ontology
 GO:1990837 sequence-specific double-stranded DNA binding
Gene Ontology
 GO:1903508 positive regulation of nucleic acid-templated transcription
Gene Ontology
 GO:1903507 negative regulation of nucleic acid-templated transcription
Gene Ontology
 GO:1903506 regulation of nucleic acid-templated transcription
Gene Ontology
 GO:1902680 positive regulation of RNA biosynthetic process
Gene Ontology
 GO:1902679 negative regulation of RNA biosynthetic process
Gene Ontology
 GO:1901363 heterocyclic compound binding
Gene Ontology
 GO:0140110 transcription regulator activity
Gene Ontology
 GO:0097159 organic cyclic compound binding
Gene Ontology
 GO:0080090 regulation of primary metabolic process
Gene Ontology
 GO:0071944 cell periphery
Gene Ontology
 GO:0065007 biological regulation
Gene Ontology
 GO:0060255 regulation of macromolecule metabolic process
Gene Ontology
 GO:0051254 positive regulation of RNA metabolic process
Gene Ontology
 GO:0051253 negative regulation of RNA metabolic process
Gene Ontology
 GO:0051252 regulation of RNA metabolic process
Gene Ontology
 GO:0051173 positive regulation of nitrogen compound metabolic process
Gene Ontology
 GO:0051172 negative regulation of nitrogen compound metabolic process
Gene Ontology
 GO:0051171 regulation of nitrogen compound metabolic process
Gene Ontology
 GO:0050896 response to stimulus
Gene Ontology
 GO:0050794 regulation of cellular process
Gene Ontology
 GO:0050789 regulation of biological process
Gene Ontology
 GO:0048523 negative regulation of cellular process
Gene Ontology
 GO:0048522 positive regulation of cellular process
Gene Ontology
 GO:0048519 negative regulation of biological process
Gene Ontology
 GO:0048518 positive regulation of biological process
Gene Ontology
 GO:0046983 protein dimerization activity
Gene Ontology
 GO:0046914 transition metal ion binding
Gene Ontology
 GO:0046872 metal ion binding
Gene Ontology
 GO:0045935 positive regulation of nucleobase-containing compound metabolic process
Gene Ontology
 GO:0045934 negative regulation of nucleobase-containing compound metabolic process
Gene Ontology
 GO:0045893 positive regulation of DNA-templated transcription
Gene Ontology
 GO:0045892 negative regulation of DNA-templated transcription
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044212 -
Gene Ontology
 GO:0043565 sequence-specific DNA binding
Gene Ontology
 GO:0043169 cation binding
Gene Ontology
 GO:0043167 ion binding
Gene Ontology
 GO:0042803 protein homodimerization activity
Gene Ontology
 GO:0042802 identical protein binding
Gene Ontology
 GO:0042221 response to chemical
Gene Ontology
 GO:0032993 protein-DNA complex
Gene Ontology
 GO:0032991 protein-containing complex
Gene Ontology
 GO:0031328 positive regulation of cellular biosynthetic process
Gene Ontology
 GO:0031327 negative regulation of cellular biosynthetic process
Gene Ontology
 GO:0031326 regulation of cellular biosynthetic process
Gene Ontology
 GO:0031325 positive regulation of cellular metabolic process
Gene Ontology
 GO:0031324 negative regulation of cellular metabolic process
Gene Ontology
 GO:0031323 regulation of cellular metabolic process
Gene Ontology
 GO:0019222 regulation of metabolic process
Gene Ontology
 GO:0019219 regulation of nucleobase-containing compound metabolic process
Gene Ontology
 GO:0016020 membrane
Gene Ontology
 GO:0010629 negative regulation of gene expression
Gene Ontology
 GO:0010628 positive regulation of gene expression
Gene Ontology
 GO:0010605 negative regulation of macromolecule metabolic process
Gene Ontology
 GO:0010604 positive regulation of macromolecule metabolic process
Gene Ontology
 GO:0010558 negative regulation of macromolecule biosynthetic process
Gene Ontology
 GO:0010557 positive regulation of macromolecule biosynthetic process
Gene Ontology
 GO:0010556 regulation of macromolecule biosynthetic process
Gene Ontology
 GO:0010468 regulation of gene expression
Gene Ontology
 GO:0010043 response to zinc ion
Gene Ontology
 GO:0010038 response to metal ion
Gene Ontology
 GO:0010035 response to inorganic substance
Gene Ontology
 GO:0009893 positive regulation of metabolic process
Gene Ontology
 GO:0009892 negative regulation of metabolic process
Gene Ontology
 GO:0009891 positive regulation of biosynthetic process
Gene Ontology
 GO:0009890 negative regulation of biosynthetic process
Gene Ontology
 GO:0009889 regulation of biosynthetic process
Gene Ontology
 GO:0008270 zinc ion binding
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006355 regulation of DNA-templated transcription
Gene Ontology
 GO:0005886 plasma membrane
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005515 protein binding
Gene Ontology
 GO:0005488 binding
Gene Ontology
 GO:0003700 DNA-binding transcription factor activity
Gene Ontology
 GO:0003690 double-stranded DNA binding
Gene Ontology
 GO:0003677 DNA binding
Gene Ontology
 GO:0003676 nucleic acid binding
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0001217 DNA-binding transcription repressor activity
Gene Ontology
 GO:0001130 -
Gene Ontology
 GO:0001067 transcription regulatory region nucleic acid binding
Gene Ontology
 GO:0000976 transcription cis-regulatory region binding
Eggnog Protein
 EP:furB
Eggnog Ortholog
 EO:COG0735
Eggnog Description
 ED:Belongs to the Fur family

Sequences

Nucleotide sequence (GC-content: 67.1 %):

GTGTCGAACCCGGCGGCAAGCCCCGTCAAGCGCACCACCCGGCAGCGTGTCGCCATCAACGATCTGTTCGACGGCGAGCGTGCCTTCCTCACGGCCCAGCAGGTCCATGAGGAGCTGCGCGAGCGCGGCGTCAAGGTCGGACTCGCGACGGTCTACCGCAATCTCCAGGCGATGAGCGAGGAGGGCGAGCTGGACACCATCCGCGCCGAGGACGGCGAGATGGCGTACCGACGTTGCTCCTCCTCACACCACCACCACCTGGTGTGCCGCCAGTGCGGCAAGGTGGTCGAGATCGGCCAGGACCAGATGATCGAGTCCTGGGCGTCCGCGGTCGCTGCTCGTCACGGGTTCAGCGAGACCGGCCACGAACTGGAGCTCTTCGGGCTGTGCGCCGAGTGCTCGAGGGAGAATTCCTGA

Protein sequence:

MSNPAASPVKRTTRQRVAINDLFDGERAFLTAQQVHEELRERGVKVGLATVYRNLQAMSEEGELDTIRAEDGEMAYRRCSSSHHHHLVCRQCGKVVEIGQDQMIESWASAVAARHGFSETGHELELFGLCAECSRENS

GenBank Info

locus_tag - FAM19038-p1-1.1_002520
inference - COORDINATES: similar to AA sequence:RefSeq:WP_002515664.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - transcriptional repressor
protein_id - extdb:FAM19038-p1-1.1_002520

Gene Locus

Located on scaffold FAM19038-p1-1_scf1

Cellular location expand

Responsible annotations:
SL-0039: GO:0005886 plasma membrane
SL-0162: GO:0016020 membrane
FAM19038-p1-1.1_002519
FAM19038-p1-1.1_002521