update range to 10000 bp
locus tag: FAM19038-p1-1.1_002539 genome: FAM19038-p1-1.1
species: Acidipropionibacterium jensenii taxid: 1749

Annotations

Type Name Description Pathways
Gene Product
 winged helix-turn-helix transcriptional regulator
Ortholog
 N0.HOG0001953 winged helix-turn-helix transcriptional regulator
KEGG gene
 K21885 cmtR; ArsR family transcriptional regulator, cadmium/lead-responsive transcriptional repressor
Gene Ontology
 GO:2001141 regulation of RNA biosynthetic process
Gene Ontology
 GO:2000112 regulation of cellular macromolecule biosynthetic process
Gene Ontology
 GO:1903506 regulation of nucleic acid-templated transcription
Gene Ontology
 GO:1901363 heterocyclic compound binding
Gene Ontology
 GO:0140110 transcription regulator activity
Gene Ontology
 GO:0097159 organic cyclic compound binding
Gene Ontology
 GO:0097063 cadmium ion sensor activity
Gene Ontology
 GO:0080090 regulation of primary metabolic process
Gene Ontology
 GO:0065007 biological regulation
Gene Ontology
 GO:0060255 regulation of macromolecule metabolic process
Gene Ontology
 GO:0051252 regulation of RNA metabolic process
Gene Ontology
 GO:0051171 regulation of nitrogen compound metabolic process
Gene Ontology
 GO:0050896 response to stimulus
Gene Ontology
 GO:0050794 regulation of cellular process
Gene Ontology
 GO:0050789 regulation of biological process
Gene Ontology
 GO:0046914 transition metal ion binding
Gene Ontology
 GO:0046872 metal ion binding
Gene Ontology
 GO:0046870 cadmium ion binding
Gene Ontology
 GO:0046686 response to cadmium ion
Gene Ontology
 GO:0043169 cation binding
Gene Ontology
 GO:0043167 ion binding
Gene Ontology
 GO:0042221 response to chemical
Gene Ontology
 GO:0032791 lead ion binding
Gene Ontology
 GO:0031326 regulation of cellular biosynthetic process
Gene Ontology
 GO:0031323 regulation of cellular metabolic process
Gene Ontology
 GO:0019222 regulation of metabolic process
Gene Ontology
 GO:0019219 regulation of nucleobase-containing compound metabolic process
Gene Ontology
 GO:0010556 regulation of macromolecule biosynthetic process
Gene Ontology
 GO:0010468 regulation of gene expression
Gene Ontology
 GO:0010288 response to lead ion
Gene Ontology
 GO:0010038 response to metal ion
Gene Ontology
 GO:0010035 response to inorganic substance
Gene Ontology
 GO:0009889 regulation of biosynthetic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006355 regulation of DNA-templated transcription
Gene Ontology
 GO:0005488 binding
Gene Ontology
 GO:0003700 DNA-binding transcription factor activity
Gene Ontology
 GO:0003677 DNA binding
Gene Ontology
 GO:0003676 nucleic acid binding
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:cmtR
Eggnog Ortholog
 EO:COG0640
Eggnog Description
 ED:Bacterial regulatory protein

Sequences

Nucleotide sequence (GC-content: 65.3 %):

ATGCTGACTATTGCTTCGCGTCTCGACGTGATGAACCGCCTGGGTCGTGCACTGGCCGACCCCACTCGATCCCGGATCATCTTGACCCTGCTCGACCATCCCGCTTACCCGGCGGAACTGGCCCGAGATCTGGACCTGACACGCCCGAACGTGTCCAACCACCTGGCATGCCTGCGCGATTGCGGGATCGTCGTCTCCGAGCCCGAGGGTCGTCGGACACGATATGAGATCGCCGATTCGCACCTGGCGCAGGCGCTGACGGCACTGGTCGATGCCACCCTGGCAGTGGACGAAGACGCCCCGTGCATCGATCCCGCCTGCTCGCTTCCCGGATGCGACGCAGCTGGGGAGGGCGCATGA

Protein sequence:

MLTIASRLDVMNRLGRALADPTRSRIILTLLDHPAYPAELARDLDLTRPNVSNHLACLRDCGIVVSEPEGRRTRYEIADSHLAQALTALVDATLAVDEDAPCIDPACSLPGCDAAGEGA

GenBank Info

locus_tag - FAM19038-p1-1.1_002539
inference - COORDINATES: similar to AA sequence:RefSeq:WP_002546816.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - winged helix-turn-helix transcriptional regulator
protein_id - extdb:FAM19038-p1-1.1_002539

Gene Locus

Located on scaffold FAM19038-p1-1_scf1

FAM19038-p1-1.1_002538
FAM19038-p1-1.1_002540