Annotations

Type Name Description Pathways
KEGG reaction
R09731 (2Z,6E)-farnesyl-diphosphate:isopentenyl-diphosphate cistransferase (adding 9-11 isopentenyl units); 2-cis,6-trans-Farnesyl diphosphate + n Isopentenyl diphosphate <=> n Diphosphate + trans,polycis-Polyprenyl diphosphate kornec00900kornec01110
KEGG reaction
R09244 (2Z,6E)-farnesyl-diphosphate:isopentenyl-diphosphate farnesylcistransferase (adding 7 isopentenyl units); 2-cis,6-trans-Farnesyl diphosphate + 7 Isopentenyl diphosphate <=> trans,octacis-Decaprenyl diphosphate + 7 Diphosphate kornec00900kornec01110
KEGG reaction
R06447 (2E,6E)-farnesyl-diphosphate:isopentenyl-diphosphate cistransferase (adding 8 isopentenyl units); trans,trans-Farnesyl diphosphate + 8 Isopentenyl diphosphate <=> di-trans,poly-cis-Undecaprenyl diphosphate + 8 Diphosphate kornec00550kornec00900kornec01110
Ortholog
N0.HOG0001394 isoprenyl transferase
KEGG gene
K21273 E2.5.1.88; trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88] kornec00900kornec01110
KEGG gene
K14215 E2.5.1.86; trans,polycis-decaprenyl diphosphate synthase [EC:2.5.1.86] kornec00900kornec01110
KEGG gene
K00806 uppS; undecaprenyl diphosphate synthase [EC:2.5.1.31] kornec00550kornec00900kornec01110
Gene Product
isoprenyl transferase
Gene Ontology
GO:1901617 organic hydroxy compound biosynthetic process
Gene Ontology
GO:1901615 organic hydroxy compound metabolic process
Gene Ontology
GO:1901576 organic substance biosynthetic process
Gene Ontology
GO:0071944 cell periphery
Gene Ontology
GO:0071704 organic substance metabolic process
Gene Ontology
GO:0050347 -
Gene Ontology
GO:0046914 transition metal ion binding
Gene Ontology
GO:0046872 metal ion binding
Gene Ontology
GO:0046165 alcohol biosynthetic process
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044444 obsolete cytoplasmic part
Gene Ontology
GO:0044424 obsolete intracellular part
Gene Ontology
GO:0044283 small molecule biosynthetic process
Gene Ontology
GO:0044281 small molecule metabolic process
Gene Ontology
GO:0044255 cellular lipid metabolic process
Gene Ontology
GO:0044249 cellular biosynthetic process
Gene Ontology
GO:0044238 primary metabolic process
Gene Ontology
GO:0044237 cellular metabolic process
Gene Ontology
GO:0043169 cation binding
Gene Ontology
GO:0043167 ion binding
Gene Ontology
GO:0040007 growth
Gene Ontology
GO:0033850 Z-farnesyl diphosphate synthase activity
Gene Ontology
GO:0030145 manganese ion binding
Gene Ontology
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
Gene Ontology
GO:0016740 transferase activity
Gene Ontology
GO:0016094 polyprenol biosynthetic process
Gene Ontology
GO:0016093 polyprenol metabolic process
Gene Ontology
GO:0016020 membrane
Gene Ontology
GO:0009987 cellular process
Gene Ontology
GO:0009058 biosynthetic process
Gene Ontology
GO:0008834 di-trans,poly-cis-decaprenylcistransferase activity
Gene Ontology
GO:0008610 lipid biosynthetic process
Gene Ontology
GO:0008299 isoprenoid biosynthetic process
Gene Ontology
GO:0008152 metabolic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0006720 isoprenoid metabolic process
Gene Ontology
GO:0006629 lipid metabolic process
Gene Ontology
GO:0006066 alcohol metabolic process
Gene Ontology
GO:0005886 plasma membrane
Gene Ontology
GO:0005829 cytosol
Gene Ontology
GO:0005737 cytoplasm
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005622 intracellular anatomical structure
Gene Ontology
GO:0005575 cellular_component
Gene Ontology
GO:0005488 binding
Gene Ontology
GO:0004659 prenyltransferase activity
Gene Ontology
GO:0003824 catalytic activity
Gene Ontology
GO:0003674 molecular_function
Gene Ontology
GO:0002094 polyprenyltransferase activity
Gene Ontology
GO:0000287 magnesium ion binding
Eggnog Protein
EP:uppS
Eggnog Ortholog
EO:COG0020
Eggnog Description
ED:Catalyzes the condensation of isopentenyl diphosphate (IPP) with allylic pyrophosphates generating different type of terpenoids
EC Number
EC:2.5.1.88 trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific] kornec00900kornec01110
EC Number
EC:2.5.1.86 trans,polycis-decaprenyl diphosphate synthase; Rv2361c; (2Z,6Z,10Z,14Z,18Z,22Z,26Z,30Z,34E)-decaprenyl diphosphate synthase kornec00900kornec01110
EC Number
EC:2.5.1.31 ditrans,polycis-undecaprenyl-diphosphate synthase [(2E,6E)-farnesyl-diphosphate specific]; di-trans,poly-cis-undecaprenyl-diphosphate synthase; undecaprenyl-diphosphate synthase; bactoprenyl-diphosphate synthase; UPP synthetase; undecaprenyl diphosphate synthetase; undecaprenyl pyrophosphate synthetase; di-trans,poly-cis-decaprenylcistransferase kornec00550kornec00900kornec01110

Occurs in the following pathway maps:

Pathway Description
kornec00550 Peptidoglycan biosynthesis
kornec00900 Terpenoid backbone biosynthesis
kornec01110 Biosynthesis of secondary metabolites

Sequences

Nucleotide sequence (GC-content: 71.3 %):

ATGGCCTCCAGCACCCGTCCGCGTCCCGCCAAGCGCGGCCCACTCCCCCACCCCTCGGGCGCCCGCCCGCCGCAGCTGCCCGCAGAGCTGCTGCCCCGTCACGTCGCGATCGTGATGGACGGCAACGGACGCTGGGCCAAGGAGCGCGGCCTGCGACGCACCGAGGGTCACGCCCGCGGCGAGGACGCCCTTTTCGATGTCATCGAGGGGGCCATCGAGATGGGCATCCCCTACCTGTCGGCCTACGCCTTCTCCACCGAGAACTGGCGCCGGTCCCCCGACGAGGTGCACTGGCTGATGGGGTTCAACCGCGATGTCATCCACCGACGTCGCGACCAGCTCGACGCCCTCGGGGTGCGCGTCCGATGGGCGGGACGCCGTCCCAGGCTCTGGCGCTCGGTGATCCGCGAGCTCGAGGAGGCCGAGGCCCAGAGCGAGGACAACACCGTCCTCACCCTGCAGTTCTGCGTCAACTACGGGGGACGGGCCGAGATCGTCGACGCCGTCCGCGACATCGCCCGGCTGGCCGCCGAGGGCCGGCTGGACCCCGACCACATCACCGAGAAGACCTTCCGCACCCACCTGGACGAGCCGGAGATCCCCGATGTGGACCTGTTCTGGCGCTCCTCGGGGGAGCAGCGGACCTCCAACTTCCTGCTGTGGCAGTCGGCCTACGCCGAGATGGTCTTCTCCGACGTGCTGTGGCCCGATGTGGACCGGCGCAACCTGTGGGACGCCGTGATGGAGTACGCCCGCCGCGACCGGCGGTTCGGCGGTGCGGTGCCCAACGAGACCCCCACCACCGACGCCGGGGCCCGCTGA

Protein sequence:

MASSTRPRPAKRGPLPHPSGARPPQLPAELLPRHVAIVMDGNGRWAKERGLRRTEGHARGEDALFDVIEGAIEMGIPYLSAYAFSTENWRRSPDEVHWLMGFNRDVIHRRRDQLDALGVRVRWAGRRPRLWRSVIRELEEAEAQSEDNTVLTLQFCVNYGGRAEIVDAVRDIARLAAEGRLDPDHITEKTFRTHLDEPEIPDVDLFWRSSGEQRTSNFLLWQSAYAEMVFSDVLWPDVDRRNLWDAVMEYARRDRRFGGAVPNETPTTDAGAR

GenBank Info

locus_tag - FAM19038-p1-1.1_002550
inference - COORDINATES: similar to AA sequence:RefSeq:WP_002513780.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - isoprenyl transferase
protein_id - extdb:FAM19038-p1-1.1_002550

Gene Locus

Located on scaffold FAM19038-p1-1_scf1


Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
SL-0039: GO:0005886 plasma membrane
SL-0162: GO:0016020 membrane

FAM19038-p1-1.1_002549
FAM19038-p1-1.1_002551