update range to 10000 bp
locus tag: FAM19038-p1-1.1_002656 genome: FAM19038-p1-1.1
species: Acidipropionibacterium jensenii taxid: 1749

Annotations

Type Name Description Pathways
KEGG reaction
 R03005 ATP:nicotinamide-nucleotide adenylyltransferase; ATP + Nicotinate D-ribonucleotide <=> Diphosphate + Deamino-NAD+ kornec00760kornec01100kornec01240
KEGG reaction
 R00137 ATP:nicotinamide-nucleotide adenylyltransferase; ATP + Nicotinamide D-ribonucleotide <=> Diphosphate + NAD+ kornec00760kornec01100
Gene Product
 nicotinate-nucleotide adenylyltransferase
Ortholog
 N0.HOG0001108 nicotinate-nucleotide adenylyltransferase
KEGG gene
 K00969 nadD; nicotinate-nucleotide adenylyltransferase [EC:2.7.7.18] kornec00760kornec01100kornec01240
Gene Ontology
 GO:1901605 alpha-amino acid metabolic process
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:1901362 organic cyclic compound biosynthetic process
Gene Ontology
 GO:1901360 organic cyclic compound metabolic process
Gene Ontology
 GO:1901293 nucleoside phosphate biosynthetic process
Gene Ontology
 GO:0090407 organophosphate biosynthetic process
Gene Ontology
 GO:0072525 pyridine-containing compound biosynthetic process
Gene Ontology
 GO:0072524 pyridine-containing compound metabolic process
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0070566 adenylyltransferase activity
Gene Ontology
 GO:0055086 nucleobase-containing small molecule metabolic process
Gene Ontology
 GO:0051188 obsolete cofactor biosynthetic process
Gene Ontology
 GO:0051186 obsolete cofactor metabolic process
Gene Ontology
 GO:0046496 nicotinamide nucleotide metabolic process
Gene Ontology
 GO:0046483 heterocycle metabolic process
Gene Ontology
 GO:0044281 small molecule metabolic process
Gene Ontology
 GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0043648 dicarboxylic acid metabolic process
Gene Ontology
 GO:0043436 oxoacid metabolic process
Gene Ontology
 GO:0040007 growth
Gene Ontology
 GO:0034654 nucleobase-containing compound biosynthetic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0034628 'de novo' NAD biosynthetic process from aspartate
Gene Ontology
 GO:0034627 'de novo' NAD biosynthetic process
Gene Ontology
 GO:0019752 carboxylic acid metabolic process
Gene Ontology
 GO:0019674 NAD metabolic process
Gene Ontology
 GO:0019637 organophosphate metabolic process
Gene Ontology
 GO:0019438 aromatic compound biosynthetic process
Gene Ontology
 GO:0019363 pyridine nucleotide biosynthetic process
Gene Ontology
 GO:0019362 pyridine nucleotide metabolic process
Gene Ontology
 GO:0019359 nicotinamide nucleotide biosynthetic process
Gene Ontology
 GO:0019355 -
Gene Ontology
 GO:0018130 heterocycle biosynthetic process
Gene Ontology
 GO:0016779 nucleotidyltransferase activity
Gene Ontology
 GO:0016772 transferase activity, transferring phosphorus-containing groups
Gene Ontology
 GO:0016740 transferase activity
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009435 NAD biosynthetic process
Gene Ontology
 GO:0009165 nucleotide biosynthetic process
Gene Ontology
 GO:0009117 nucleotide metabolic process
Gene Ontology
 GO:0009108 obsolete coenzyme biosynthetic process
Gene Ontology
 GO:0009066 aspartate family amino acid metabolic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006796 phosphate-containing compound metabolic process
Gene Ontology
 GO:0006793 phosphorus metabolic process
Gene Ontology
 GO:0006753 nucleoside phosphate metabolic process
Gene Ontology
 GO:0006733 obsolete oxidoreduction coenzyme metabolic process
Gene Ontology
 GO:0006732 obsolete coenzyme metabolic process
Gene Ontology
 GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
 GO:0006531 aspartate metabolic process
Gene Ontology
 GO:0006520 cellular amino acid metabolic process
Gene Ontology
 GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
 GO:0006082 organic acid metabolic process
Gene Ontology
 GO:0004515 nicotinate-nucleotide adenylyltransferase activity
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0000309 nicotinamide-nucleotide adenylyltransferase activity
Eggnog Protein
 EP:nadD
Eggnog Ortholog
 EO:COG1057
Eggnog Description
 ED:Catalyzes the reversible adenylation of nicotinate mononucleotide (NaMN) to nicotinic acid adenine dinucleotide (NaAD)
EC Number
 EC:2.7.7.18 nicotinate-nucleotide adenylyltransferase; deamido-NAD+ pyrophosphorylase; nicotinate mononucleotide adenylyltransferase; deamidonicotinamide adenine dinucleotide pyrophosphorylase; NaMN-ATase; nicotinic acid mononucleotide adenylyltransferase kornec00760kornec01100

Occurs in the following pathway maps:

Pathway Description
kornec00760 Nicotinate and nicotinamide metabolism
kornec01100 Metabolic pathways
kornec01240 Biosynthesis of cofactors

Sequences

Nucleotide sequence (GC-content: 67.0 %):

ATGAGCAACAGCGTGGAACTTGGACTTGCGCGCGCCCATGACGGTCGCCGCTACCGACTGGGTGTGATGGGTGGCACCTTCGACCCGATTCACCACGGACACCTGGTGGCCGCCTCCGAGGTGGCCTCGCGGTTCGGCCTCGACGAGGTCGTCTTCGTGCCGACCGGGGTGCCCTGGCAGAAGAAGGGCCGCAACGTCTCCCTGGCCGAGGACCGGTACCTCATGACGGTCATCGCGACCGCCTCGAACCCCTCCTTCTCGGTCTCCCGGGTCGACATCGACCGGCTGGGGGACACCTACACCGTCGACACCCTCAAGGACCTGCGGCGTGAGAGGGGCGCCGACGTCGACCTGTTCTTCATCACCGGCGCCGACGCCCTGTCGCACATCCTCACCTGGCGGGGGGCCGAGGAGCTCTTCGACCTCGCGCACTTCGTGGGGGTATCGCGGCCCGGGGTACCGTTCGGCAGGAAGGACATCTCCCACCTGCCGGCCGACAAGGTGACCCTGCTCGAGGTGCCGGCGATGGCGATCTCCTCGACCGACTGCCGCAGGCGGGTCTACACCGGCCTGCCGATCTGGTACCTGGTGCCCGACGGCATCGTGCAGTACATCAACAAACGTGGGTTGTACGGACAACCCGACCATCCGGAGGACCATTGA

Protein sequence:

MSNSVELGLARAHDGRRYRLGVMGGTFDPIHHGHLVAASEVASRFGLDEVVFVPTGVPWQKKGRNVSLAEDRYLMTVIATASNPSFSVSRVDIDRLGDTYTVDTLKDLRRERGADVDLFFITGADALSHILTWRGAEELFDLAHFVGVSRPGVPFGRKDISHLPADKVTLLEVPAMAISSTDCRRRVYTGLPIWYLVPDGIVQYINKRGLYGQPDHPEDH

GenBank Info

locus_tag - FAM19038-p1-1.1_002656
EC_number - 2.7.7.18
inference - COORDINATES: similar to AA sequence:RefSeq:WP_015070066.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - nicotinate-nucleotide adenylyltransferase
protein_id - extdb:FAM19038-p1-1.1_002656

Gene Locus

Located on scaffold FAM19038-p1-1_scf1

FAM19038-p1-1.1_002655
FAM19038-p1-1.1_002657