update range to 10000 bp
locus tag: FAM19038-p1-1.1_002661 genome: FAM19038-p1-1.1
species: Acidipropionibacterium jensenii taxid: 1749

Annotations

Type Name Description Pathways
Gene Code
 rpmA
Ortholog
 N0.HOG0001230 50S ribosomal protein L27
KEGG gene
 K02899 RP-L27, MRPL27, rpmA; large subunit ribosomal protein L27 kornec03010
Gene Ontology
 GO:1990904 ribonucleoprotein complex
Gene Ontology
 GO:0071944 cell periphery
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044446 obsolete intracellular organelle part
Gene Ontology
 GO:0044445 obsolete cytosolic part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044422 obsolete organelle part
Gene Ontology
 GO:0044391 ribosomal subunit
Gene Ontology
 GO:0043232 intracellular non-membrane-bounded organelle
Gene Ontology
 GO:0043229 intracellular organelle
Gene Ontology
 GO:0043228 non-membrane-bounded organelle
Gene Ontology
 GO:0043226 organelle
Gene Ontology
 GO:0040007 growth
Gene Ontology
 GO:0032991 protein-containing complex
Gene Ontology
 GO:0030312 external encapsulating structure
Gene Ontology
 GO:0022626 cytosolic ribosome
Gene Ontology
 GO:0022625 cytosolic large ribosomal subunit
Gene Ontology
 GO:0016020 membrane
Gene Ontology
 GO:0015934 large ribosomal subunit
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0005886 plasma membrane
Gene Ontology
 GO:0005840 ribosome
Gene Ontology
 GO:0005829 cytosol
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005618 cell wall
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005198 structural molecule activity
Gene Ontology
 GO:0003735 structural constituent of ribosome
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:rpmA
Eggnog Ortholog
 EO:COG0211
Eggnog Description
 ED:Belongs to the bacterial ribosomal protein bL27 family
Gene Product
 50S ribosomal protein L27

Occurs in the following pathway maps:

Pathway Description
kornec03010 Ribosome

Sequences

Nucleotide sequence (GC-content: 69.6 %):

ATGGCACACAAGAAGGGCGCATCCTCGTCCCGCAACGGCCGCGACTCCAACGCTCAGCGTCTGGGCGTCAAGCGGTTCGGCGGTCAGCTGGTCAACGCCGGCGAGATCATCATCCGTCAGCGCGGCACCCACTTCCACCCCGGCAAGGGGGTCGGCCGCGGCAAGGATGACACACTGTTCGCGCTGCGCGCCGGCAACGTCGCCTTCGGCAGCCGTCGCGGCCGCCGCGTGATCGACGTCGTTCCGGTCGAGGAGCCCGCTCAGGCCTGA

Protein sequence:

MAHKKGASSSRNGRDSNAQRLGVKRFGGQLVNAGEIIIRQRGTHFHPGKGVGRGKDDTLFALRAGNVAFGSRRGRRVIDVVPVEEPAQA

GenBank Info

gene - rpmA
locus_tag - FAM19038-p1-1.1_002661
inference - COORDINATES: similar to AA sequence:RefSeq:WP_002513859.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 50S ribosomal protein L27
protein_id - extdb:FAM19038-p1-1.1_002661

Gene Locus

Located on scaffold FAM19038-p1-1_scf1

Cellular location expand

Responsible annotations:
SL-0041: GO:0005618 cell wall
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
SL-0039: GO:0005886 plasma membrane
SL-0162: GO:0016020 membrane
FAM19038-p1-1.1_002660
FAM19038-p1-1.1_002662