update range to 10000 bp
locus tag: FAM19038-p1-1.1_002670 genome: FAM19038-p1-1.1
species: Acidipropionibacterium jensenii taxid: 1749

Annotations

Type Name Description Pathways
Gene Product
 triose-phosphate isomerase
KEGG reaction
 R01015 D-glyceraldehyde-3-phosphate aldose-ketose-isomerase; D-Glyceraldehyde 3-phosphate <=> Glycerone phosphate kornec00010kornec00051kornec00562kornec00710kornec01100kornec01110kornec01120kornec01200kornec01230
Ortholog
 N0.HOG0001166 triose-phosphate isomerase
KEGG gene
 K01803 TPI, tpiA; triosephosphate isomerase (TIM) [EC:5.3.1.1] kornec00010kornec00051kornec00562kornec00710kornec01100kornec01110kornec01120kornec01200kornec01230
Gene Ontology
 GO:1901616 organic hydroxy compound catabolic process
Gene Ontology
 GO:1901615 organic hydroxy compound metabolic process
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901575 organic substance catabolic process
Gene Ontology
 GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:1901362 organic cyclic compound biosynthetic process
Gene Ontology
 GO:1901361 organic cyclic compound catabolic process
Gene Ontology
 GO:1901360 organic cyclic compound metabolic process
Gene Ontology
 GO:1901293 nucleoside phosphate biosynthetic process
Gene Ontology
 GO:1901292 nucleoside phosphate catabolic process
Gene Ontology
 GO:1901137 carbohydrate derivative biosynthetic process
Gene Ontology
 GO:1901135 carbohydrate derivative metabolic process
Gene Ontology
 GO:0090407 organophosphate biosynthetic process
Gene Ontology
 GO:0072525 pyridine-containing compound biosynthetic process
Gene Ontology
 GO:0072524 pyridine-containing compound metabolic process
Gene Ontology
 GO:0072522 purine-containing compound biosynthetic process
Gene Ontology
 GO:0072521 purine-containing compound metabolic process
Gene Ontology
 GO:0072330 monocarboxylic acid biosynthetic process
Gene Ontology
 GO:0071944 cell periphery
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0055086 nucleobase-containing small molecule metabolic process
Gene Ontology
 GO:0051188 obsolete cofactor biosynthetic process
Gene Ontology
 GO:0051186 obsolete cofactor metabolic process
Gene Ontology
 GO:0046939 nucleotide phosphorylation
Gene Ontology
 GO:0046700 heterocycle catabolic process
Gene Ontology
 GO:0046496 nicotinamide nucleotide metabolic process
Gene Ontology
 GO:0046483 heterocycle metabolic process
Gene Ontology
 GO:0046434 organophosphate catabolic process
Gene Ontology
 GO:0046394 carboxylic acid biosynthetic process
Gene Ontology
 GO:0046390 ribose phosphate biosynthetic process
Gene Ontology
 GO:0046364 monosaccharide biosynthetic process
Gene Ontology
 GO:0046184 aldehyde biosynthetic process
Gene Ontology
 GO:0046174 polyol catabolic process
Gene Ontology
 GO:0046166 glyceraldehyde-3-phosphate biosynthetic process
Gene Ontology
 GO:0046164 alcohol catabolic process
Gene Ontology
 GO:0046034 ATP metabolic process
Gene Ontology
 GO:0046031 ADP metabolic process
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044283 small molecule biosynthetic process
Gene Ontology
 GO:0044282 small molecule catabolic process
Gene Ontology
 GO:0044281 small molecule metabolic process
Gene Ontology
 GO:0044275 cellular carbohydrate catabolic process
Gene Ontology
 GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
 GO:0044270 cellular nitrogen compound catabolic process
Gene Ontology
 GO:0044262 cellular carbohydrate metabolic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044248 cellular catabolic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0043436 oxoacid metabolic process
Gene Ontology
 GO:0042866 pyruvate biosynthetic process
Gene Ontology
 GO:0040007 growth
Gene Ontology
 GO:0034655 nucleobase-containing compound catabolic process
Gene Ontology
 GO:0034654 nucleobase-containing compound biosynthetic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0034404 nucleobase-containing small molecule biosynthetic process
Gene Ontology
 GO:0032787 monocarboxylic acid metabolic process
Gene Ontology
 GO:0019752 carboxylic acid metabolic process
Gene Ontology
 GO:0019751 polyol metabolic process
Gene Ontology
 GO:0019693 ribose phosphate metabolic process
Gene Ontology
 GO:0019682 glyceraldehyde-3-phosphate metabolic process
Gene Ontology
 GO:0019637 organophosphate metabolic process
Gene Ontology
 GO:0019563 glycerol catabolic process
Gene Ontology
 GO:0019439 aromatic compound catabolic process
Gene Ontology
 GO:0019438 aromatic compound biosynthetic process
Gene Ontology
 GO:0019405 alditol catabolic process
Gene Ontology
 GO:0019400 alditol metabolic process
Gene Ontology
 GO:0019363 pyridine nucleotide biosynthetic process
Gene Ontology
 GO:0019362 pyridine nucleotide metabolic process
Gene Ontology
 GO:0019359 nicotinamide nucleotide biosynthetic process
Gene Ontology
 GO:0019319 hexose biosynthetic process
Gene Ontology
 GO:0019318 hexose metabolic process
Gene Ontology
 GO:0018130 heterocycle biosynthetic process
Gene Ontology
 GO:0017144 -
Gene Ontology
 GO:0016861 intramolecular oxidoreductase activity, interconverting aldoses and ketoses
Gene Ontology
 GO:0016860 intramolecular oxidoreductase activity
Gene Ontology
 GO:0016853 isomerase activity
Gene Ontology
 GO:0016310 phosphorylation
Gene Ontology
 GO:0016053 organic acid biosynthetic process
Gene Ontology
 GO:0016052 carbohydrate catabolic process
Gene Ontology
 GO:0016051 carbohydrate biosynthetic process
Gene Ontology
 GO:0016020 membrane
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009260 ribonucleotide biosynthetic process
Gene Ontology
 GO:0009259 ribonucleotide metabolic process
Gene Ontology
 GO:0009206 purine ribonucleoside triphosphate biosynthetic process
Gene Ontology
 GO:0009205 purine ribonucleoside triphosphate metabolic process
Gene Ontology
 GO:0009201 ribonucleoside triphosphate biosynthetic process
Gene Ontology
 GO:0009199 ribonucleoside triphosphate metabolic process
Gene Ontology
 GO:0009185 ribonucleoside diphosphate metabolic process
Gene Ontology
 GO:0009179 purine ribonucleoside diphosphate metabolic process
Gene Ontology
 GO:0009168 purine ribonucleoside monophosphate biosynthetic process
Gene Ontology
 GO:0009167 purine ribonucleoside monophosphate metabolic process
Gene Ontology
 GO:0009166 nucleotide catabolic process
Gene Ontology
 GO:0009165 nucleotide biosynthetic process
Gene Ontology
 GO:0009161 ribonucleoside monophosphate metabolic process
Gene Ontology
 GO:0009156 ribonucleoside monophosphate biosynthetic process
Gene Ontology
 GO:0009152 purine ribonucleotide biosynthetic process
Gene Ontology
 GO:0009150 purine ribonucleotide metabolic process
Gene Ontology
 GO:0009145 purine nucleoside triphosphate biosynthetic process
Gene Ontology
 GO:0009144 purine nucleoside triphosphate metabolic process
Gene Ontology
 GO:0009142 nucleoside triphosphate biosynthetic process
Gene Ontology
 GO:0009141 nucleoside triphosphate metabolic process
Gene Ontology
 GO:0009135 purine nucleoside diphosphate metabolic process
Gene Ontology
 GO:0009132 nucleoside diphosphate metabolic process
Gene Ontology
 GO:0009127 purine nucleoside monophosphate biosynthetic process
Gene Ontology
 GO:0009126 purine nucleoside monophosphate metabolic process
Gene Ontology
 GO:0009124 nucleoside monophosphate biosynthetic process
Gene Ontology
 GO:0009123 nucleoside monophosphate metabolic process
Gene Ontology
 GO:0009117 nucleotide metabolic process
Gene Ontology
 GO:0009108 obsolete coenzyme biosynthetic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0009056 catabolic process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006796 phosphate-containing compound metabolic process
Gene Ontology
 GO:0006793 phosphorus metabolic process
Gene Ontology
 GO:0006757 ATP generation from ADP
Gene Ontology
 GO:0006754 ATP biosynthetic process
Gene Ontology
 GO:0006753 nucleoside phosphate metabolic process
Gene Ontology
 GO:0006733 obsolete oxidoreduction coenzyme metabolic process
Gene Ontology
 GO:0006732 obsolete coenzyme metabolic process
Gene Ontology
 GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
 GO:0006165 nucleoside diphosphate phosphorylation
Gene Ontology
 GO:0006164 purine nucleotide biosynthetic process
Gene Ontology
 GO:0006163 purine nucleotide metabolic process
Gene Ontology
 GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
 GO:0006096 glycolytic process
Gene Ontology
 GO:0006094 gluconeogenesis
Gene Ontology
 GO:0006091 generation of precursor metabolites and energy
Gene Ontology
 GO:0006090 pyruvate metabolic process
Gene Ontology
 GO:0006082 organic acid metabolic process
Gene Ontology
 GO:0006081 cellular aldehyde metabolic process
Gene Ontology
 GO:0006071 glycerol metabolic process
Gene Ontology
 GO:0006066 alcohol metabolic process
Gene Ontology
 GO:0006006 glucose metabolic process
Gene Ontology
 GO:0005996 monosaccharide metabolic process
Gene Ontology
 GO:0005975 carbohydrate metabolic process
Gene Ontology
 GO:0005886 plasma membrane
Gene Ontology
 GO:0005829 cytosol
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005576 extracellular region
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0004807 triose-phosphate isomerase activity
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:tpiA
Eggnog Ortholog
 EO:COG0149
Eggnog Description
 ED:Involved in the gluconeogenesis. Catalyzes stereospecifically the conversion of dihydroxyacetone phosphate (DHAP) to D-glyceraldehyde-3-phosphate (G3P)
EC Number
 EC:5.3.1.1 triose-phosphate isomerase; phosphotriose isomerase; triose phosphoisomerase; triose phosphate mutase; D-glyceraldehyde-3-phosphate ketol-isomerase kornec00010kornec00051kornec00562kornec00710kornec01100kornec01110kornec01120

Occurs in the following pathway maps:

Pathway Description
kornec00010 Glycolysis / Gluconeogenesis
kornec00051 Fructose and mannose metabolism
kornec00562 Inositol phosphate metabolism
kornec00710 Carbon fixation in photosynthetic organisms
kornec01100 Metabolic pathways
kornec01110 Biosynthesis of secondary metabolites
kornec01120 Microbial metabolism in diverse environments
kornec01200 Carbon metabolism
kornec01230 Biosynthesis of amino acids

Sequences

Nucleotide sequence (GC-content: 67.7 %):

ATGTCCCGCAAGCCGATTCTGGCCGGAAACTGGAAGATGAACCTGGACCACCTGGCCGGCCTGAGCCTGGTCCAGGACCTGGGTGCAGCCCTGGCCGACAAGGACCACGACCCCAGCAAGGCCGAGGCCGTCGTCATCCCGCCGTTCACCGACATCCGCACCGTCCAGGTGCTGGTCGAGGGCGACAAGCTGCCGATCGCCTGGGGAGCCCAGGACATCTCGGCCCACGATGACGGCGCCTACACCGGAGAGATCTCCGGCTCGATGCTGGCTGCACTCAAGTGCTCCTACGTCGTCGTCGGCCACTCCGAGCGCCGCCAGTACCACGCCGAGTCCGACGCGCTGGTCAACGCCAAGGCCAAGAAGGTCATCGAGTACGGGATGACCCCGATCATCTGCTGCGGCGAGGCCCTCGAGGTCCGCAAGGCCGGCAAGCACGTCGAGCACACGGTGGCTCAGATCGAGGGCGCGCTGGCCGGGATCGACGCCGCCGATGTCGCCAAGCTCGTCATCGCCTACGAGCCCATCTGGGCAATCGGCACCGGCGAGACCGCCACCGCCGACGACGCCCAGGAGGTCTGCGGCGCGATCCGCAAGGCCGTCGAGAAGCTCTACGACGCCCCGACCGCCGAGGCCGTCCGGATCCAGTACGGCGGCTCCGTCAAGCCGGGCAATGTCGTCGAGATCATGAGCAAGTCCGACGTCGACGGCGCGCTGGTCGGAGGGGCCTCCCTCAAGGCCGGCGACTTCGCCGACATCGTCACCTTCTACCAGAAGTGA

Protein sequence:

MSRKPILAGNWKMNLDHLAGLSLVQDLGAALADKDHDPSKAEAVVIPPFTDIRTVQVLVEGDKLPIAWGAQDISAHDDGAYTGEISGSMLAALKCSYVVVGHSERRQYHAESDALVNAKAKKVIEYGMTPIICCGEALEVRKAGKHVEHTVAQIEGALAGIDAADVAKLVIAYEPIWAIGTGETATADDAQEVCGAIRKAVEKLYDAPTAEAVRIQYGGSVKPGNVVEIMSKSDVDGALVGGASLKAGDFADIVTFYQK

GenBank Info

locus_tag - FAM19038-p1-1.1_002670
EC_number - 5.3.1.1
inference - COORDINATES: similar to AA sequence:RefSeq:WP_015070049.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - triose-phosphate isomerase
protein_id - extdb:FAM19038-p1-1.1_002670

Gene Locus

Located on scaffold FAM19038-p1-1_scf1

Cellular location expand

Responsible annotations:
SL-0243: GO:0005576 extracellular region
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
SL-0039: GO:0005886 plasma membrane
SL-0162: GO:0016020 membrane
FAM19038-p1-1.1_002669
FAM19038-p1-1.1_002671