update range to 10000 bp
locus tag: FAM19038-p1-1.1_002685 genome: FAM19038-p1-1.1
species: Acidipropionibacterium jensenii taxid: 1749

Annotations

Type Name Description Pathways
KEGG reaction
 R00130 ATP:dephospho-CoA 3'-phosphotransferase; ATP + Dephospho-CoA <=> ADP + CoA kornec00770kornec01100kornec01240
Ortholog
 N0.HOG0001225 dephospho-CoA kinase
KEGG gene
 K00859 coaE; dephospho-CoA kinase [EC:2.7.1.24] kornec00770kornec01100kornec01240
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:1901363 heterocyclic compound binding
Gene Ontology
 GO:1901362 organic cyclic compound biosynthetic process
Gene Ontology
 GO:1901360 organic cyclic compound metabolic process
Gene Ontology
 GO:1901293 nucleoside phosphate biosynthetic process
Gene Ontology
 GO:1901265 nucleoside phosphate binding
Gene Ontology
 GO:1901137 carbohydrate derivative biosynthetic process
Gene Ontology
 GO:1901135 carbohydrate derivative metabolic process
Gene Ontology
 GO:0097367 carbohydrate derivative binding
Gene Ontology
 GO:0097159 organic cyclic compound binding
Gene Ontology
 GO:0090407 organophosphate biosynthetic process
Gene Ontology
 GO:0072522 purine-containing compound biosynthetic process
Gene Ontology
 GO:0072521 purine-containing compound metabolic process
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0055086 nucleobase-containing small molecule metabolic process
Gene Ontology
 GO:0051188 obsolete cofactor biosynthetic process
Gene Ontology
 GO:0051186 obsolete cofactor metabolic process
Gene Ontology
 GO:0046483 heterocycle metabolic process
Gene Ontology
 GO:0046390 ribose phosphate biosynthetic process
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044281 small molecule metabolic process
Gene Ontology
 GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0043168 anion binding
Gene Ontology
 GO:0043167 ion binding
Gene Ontology
 GO:0040007 growth
Gene Ontology
 GO:0036094 small molecule binding
Gene Ontology
 GO:0034654 nucleobase-containing compound biosynthetic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0034033 purine nucleoside bisphosphate biosynthetic process
Gene Ontology
 GO:0034032 purine nucleoside bisphosphate metabolic process
Gene Ontology
 GO:0034030 ribonucleoside bisphosphate biosynthetic process
Gene Ontology
 GO:0033875 ribonucleoside bisphosphate metabolic process
Gene Ontology
 GO:0033866 nucleoside bisphosphate biosynthetic process
Gene Ontology
 GO:0033865 nucleoside bisphosphate metabolic process
Gene Ontology
 GO:0032564 dATP binding
Gene Ontology
 GO:0032558 adenyl deoxyribonucleotide binding
Gene Ontology
 GO:0032557 pyrimidine ribonucleotide binding
Gene Ontology
 GO:0032554 purine deoxyribonucleotide binding
Gene Ontology
 GO:0032553 ribonucleotide binding
Gene Ontology
 GO:0032552 deoxyribonucleotide binding
Gene Ontology
 GO:0032551 pyrimidine ribonucleoside binding
Gene Ontology
 GO:0032549 ribonucleoside binding
Gene Ontology
 GO:0030554 adenyl nucleotide binding
Gene Ontology
 GO:0019693 ribose phosphate metabolic process
Gene Ontology
 GO:0019637 organophosphate metabolic process
Gene Ontology
 GO:0019438 aromatic compound biosynthetic process
Gene Ontology
 GO:0019103 pyrimidine nucleotide binding
Gene Ontology
 GO:0018130 heterocycle biosynthetic process
Gene Ontology
 GO:0017076 purine nucleotide binding
Gene Ontology
 GO:0016773 phosphotransferase activity, alcohol group as acceptor
Gene Ontology
 GO:0016772 transferase activity, transferring phosphorus-containing groups
Gene Ontology
 GO:0016740 transferase activity
Gene Ontology
 GO:0016310 phosphorylation
Gene Ontology
 GO:0016301 kinase activity
Gene Ontology
 GO:0015937 coenzyme A biosynthetic process
Gene Ontology
 GO:0015936 coenzyme A metabolic process
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009260 ribonucleotide biosynthetic process
Gene Ontology
 GO:0009259 ribonucleotide metabolic process
Gene Ontology
 GO:0009165 nucleotide biosynthetic process
Gene Ontology
 GO:0009152 purine ribonucleotide biosynthetic process
Gene Ontology
 GO:0009150 purine ribonucleotide metabolic process
Gene Ontology
 GO:0009117 nucleotide metabolic process
Gene Ontology
 GO:0009108 obsolete coenzyme biosynthetic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006796 phosphate-containing compound metabolic process
Gene Ontology
 GO:0006793 phosphorus metabolic process
Gene Ontology
 GO:0006753 nucleoside phosphate metabolic process
Gene Ontology
 GO:0006732 obsolete coenzyme metabolic process
Gene Ontology
 GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
 GO:0006164 purine nucleotide biosynthetic process
Gene Ontology
 GO:0006163 purine nucleotide metabolic process
Gene Ontology
 GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
 GO:0005829 cytosol
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005488 binding
Gene Ontology
 GO:0004140 dephospho-CoA kinase activity
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0002135 CTP binding
Gene Ontology
 GO:0001884 pyrimidine nucleoside binding
Gene Ontology
 GO:0001882 nucleoside binding
Gene Ontology
 GO:0000166 nucleotide binding
Eggnog Protein
 EP:coaE
Eggnog Ortholog
 EO:COG0237
Eggnog Description
 ED:Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A
EC Number
 EC:2.7.1.24 dephospho-CoA kinase; dephosphocoenzyme A kinase (phosphorylating); 3'-dephospho-CoA kinase; dephosphocoenzyme A kinase; ATP:dephospho-CoA 3'-phosphotransferase kornec00770kornec01100
Gene Product
 dephospho-CoA kinase

Occurs in the following pathway maps:

Pathway Description
kornec00770 Pantothenate and CoA biosynthesis
kornec01100 Metabolic pathways
kornec01240 Biosynthesis of cofactors

Sequences

Nucleotide sequence (GC-content: 73.6 %):

ATGGACAGCCCTCAGCACCGCCGGCCCCGGATCGCACTGACCGGTGGGATCGCCTCGGGCAAGTCGACCGTCAGCCGACTGCTCGCCGAGCACGGCGCCCTGGTCATCGACTACGACCTGCTCTCCCACCGGGTGGTCGATCCCGGAAGCGGTGGGCTGGCCGCCGTGGTGGCCGCCTTCGGGCCCGAGGTGCTGGCTGCCGACGGCTCACTGGACCGTGCCGCGCTGGCCGGTCTGGTCTTCACCGACCCGGCTCGGCGACGCCGCCTCGAGGGGATCATCCATCCTCTGGTGGAGGTCGAGGCCGACCGCATCGAGGCCGGCGCGGCCGCCGGGCGAGTGGTCGTCCACGACCTGCCGCTGCTCGTCGAGGCCGGTCTGGCCGAGGGGTTCGACGTCGTCATCGTCACCGACATCGATCCGGACGAGCAGGTGCGTCGCGCGGTCCGCCGCGACGGCACCACCGAGGCCCACGCGAGGGCCCGGGTGGCCGCCCAGGCCGACCGGCGCCAGCGCCTGGCGGTGGCCGACATCGTCATCGACACCTCGGGCCCGCTCGACGTGCTGCCCGGGATCGTCGACGGCGTCTGGCAGCAGTTGCTCGACCTGAGGGGTCGCACCGACCGCGGCTGA

Protein sequence:

MDSPQHRRPRIALTGGIASGKSTVSRLLAEHGALVIDYDLLSHRVVDPGSGGLAAVVAAFGPEVLAADGSLDRAALAGLVFTDPARRRRLEGIIHPLVEVEADRIEAGAAAGRVVVHDLPLLVEAGLAEGFDVVIVTDIDPDEQVRRAVRRDGTTEAHARARVAAQADRRQRLAVADIVIDTSGPLDVLPGIVDGVWQQLLDLRGRTDRG

GenBank Info

locus_tag - FAM19038-p1-1.1_002685
EC_number - 2.7.1.24
inference - COORDINATES: similar to AA sequence:RefSeq:WP_015070033.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - dephospho-CoA kinase
protein_id - extdb:FAM19038-p1-1.1_002685

Gene Locus

Located on scaffold FAM19038-p1-1_scf1

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
FAM19038-p1-1.1_002684
FAM19038-p1-1.1_002686