update range to 10000 bp
locus tag: FAM19471-i1-1.1_000224 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
Gene Code
 rpsL
Ortholog
 N0.HOG0001345 30S ribosomal protein S12
KEGG gene
 K02950 RP-S12, MRPS12, rpsL; small subunit ribosomal protein S12 kornec03010
Gene Ontology
 GO:1990904 ribonucleoprotein complex
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
 GO:0044267 -
Gene Ontology
 GO:0044260 cellular macromolecule metabolic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0043604 amide biosynthetic process
Gene Ontology
 GO:0043603 cellular amide metabolic process
Gene Ontology
 GO:0043232 intracellular non-membrane-bounded organelle
Gene Ontology
 GO:0043229 intracellular organelle
Gene Ontology
 GO:0043228 non-membrane-bounded organelle
Gene Ontology
 GO:0043226 organelle
Gene Ontology
 GO:0043170 macromolecule metabolic process
Gene Ontology
 GO:0043043 peptide biosynthetic process
Gene Ontology
 GO:0034645 cellular macromolecule biosynthetic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0032991 protein-containing complex
Gene Ontology
 GO:0019538 protein metabolic process
Gene Ontology
 GO:0010467 gene expression
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009059 macromolecule biosynthetic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006518 peptide metabolic process
Gene Ontology
 GO:0006412 translation
Gene Ontology
 GO:0005840 ribosome
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005198 structural molecule activity
Gene Ontology
 GO:0003735 structural constituent of ribosome
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:rpsL
Eggnog Ortholog
 EO:COG0048
Eggnog Description
 ED:Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits
Gene Product
 30S ribosomal protein S12

Occurs in the following pathway maps:

Pathway Description
kornec03010 Ribosome

Sequences

Nucleotide sequence (GC-content: 52.9 %):

ATGCCTACCATTAACCAATTGGTTCGTAAGGGCCGCAAGAGCCACAAGGGTAAGTCAAAGTCACCTGCCCTGGGCTTTGTATACAACAGTTTTAAGAAGGAAGAAATCAAGAACCCATCACCGCAAAAGCGTGGGGTTGCTACCCGTGTTGGGACGATGACGCCAAAGAAGCCTAACTCCGCCCTGCGGAAGTACGCTCGTGTGCGTTTATCTAACCTGATCGAAGTGACGGCTTACATTCCAGGGATTGGCCACAACCTTCAGGAACACTCCGTTGTCCTGATCCGTGGGGGCCGTGTTAAGGACCTTCCTGGGGTTCGTTACCACATCATCCGTGGGACGCTTGATACCGCCGGTGTTGACGGCCGGATGCAAAGCCGTTCCAAGTACGGTGCTAAGAAGCCGAAGAAGTAA

Protein sequence:

MPTINQLVRKGRKSHKGKSKSPALGFVYNSFKKEEIKNPSPQKRGVATRVGTMTPKKPNSALRKYARVRLSNLIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGTLDTAGVDGRMQSRSKYGAKKPKK

GenBank Info

gene - rpsL
locus_tag - FAM19471-i1-1.1_000224
inference - COORDINATES: similar to AA sequence:RefSeq:WP_007122712.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 30S ribosomal protein S12
protein_id - extdb:FAM19471-i1-1.1_000224

Gene Locus

Located on scaffold FAM19471-i1-1_scf2

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
FAM19471-i1-1.1_000223
FAM19471-i1-1.1_000225