update range to 10000 bp
locus tag: FAM19471-i1-1.1_000225 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
Gene Code
 rpsG
Ortholog
 N0.HOG0001344 30S ribosomal protein S7
KEGG gene
 K02992 RP-S7, MRPS7, rpsG; small subunit ribosomal protein S7 kornec03010
Gene Ontology
 GO:1990904 ribonucleoprotein complex
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:1901363 heterocyclic compound binding
Gene Ontology
 GO:0097159 organic cyclic compound binding
Gene Ontology
 GO:0071840 cellular component organization or biogenesis
Gene Ontology
 GO:0071826 ribonucleoprotein complex subunit organization
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0070925 organelle assembly
Gene Ontology
 GO:0065003 protein-containing complex assembly
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044446 obsolete intracellular organelle part
Gene Ontology
 GO:0044445 obsolete cytosolic part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044422 obsolete organelle part
Gene Ontology
 GO:0044391 ribosomal subunit
Gene Ontology
 GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
 GO:0044267 -
Gene Ontology
 GO:0044260 cellular macromolecule metabolic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0044085 cellular component biogenesis
Gene Ontology
 GO:0043933 protein-containing complex organization
Gene Ontology
 GO:0043604 amide biosynthetic process
Gene Ontology
 GO:0043603 cellular amide metabolic process
Gene Ontology
 GO:0043232 intracellular non-membrane-bounded organelle
Gene Ontology
 GO:0043229 intracellular organelle
Gene Ontology
 GO:0043228 non-membrane-bounded organelle
Gene Ontology
 GO:0043226 organelle
Gene Ontology
 GO:0043170 macromolecule metabolic process
Gene Ontology
 GO:0043043 peptide biosynthetic process
Gene Ontology
 GO:0042274 ribosomal small subunit biogenesis
Gene Ontology
 GO:0042255 ribosome assembly
Gene Ontology
 GO:0042254 ribosome biogenesis
Gene Ontology
 GO:0034645 cellular macromolecule biosynthetic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0034622 -
Gene Ontology
 GO:0032991 protein-containing complex
Gene Ontology
 GO:0022627 cytosolic small ribosomal subunit
Gene Ontology
 GO:0022626 cytosolic ribosome
Gene Ontology
 GO:0022618 ribonucleoprotein complex assembly
Gene Ontology
 GO:0022613 ribonucleoprotein complex biogenesis
Gene Ontology
 GO:0022607 cellular component assembly
Gene Ontology
 GO:0019843 rRNA binding
Gene Ontology
 GO:0019538 protein metabolic process
Gene Ontology
 GO:0016043 cellular component organization
Gene Ontology
 GO:0015935 small ribosomal subunit
Gene Ontology
 GO:0010467 gene expression
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009059 macromolecule biosynthetic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006996 organelle organization
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006518 peptide metabolic process
Gene Ontology
 GO:0006412 translation
Gene Ontology
 GO:0005840 ribosome
Gene Ontology
 GO:0005829 cytosol
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005488 binding
Gene Ontology
 GO:0005198 structural molecule activity
Gene Ontology
 GO:0003735 structural constituent of ribosome
Gene Ontology
 GO:0003729 mRNA binding
Gene Ontology
 GO:0003723 RNA binding
Gene Ontology
 GO:0003676 nucleic acid binding
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0000028 ribosomal small subunit assembly
Eggnog Protein
 EP:rpsG
Eggnog Ortholog
 EO:COG0049
Eggnog Description
 ED:One of the primary rRNA binding proteins
Gene Product
 30S ribosomal protein S7

Occurs in the following pathway maps:

Pathway Description
kornec03010 Ribosome

Sequences

Nucleotide sequence (GC-content: 51.8 %):

ATGCCACGTAAGGGACATGTAGCAAAGCCGGAAGTTTTACCGGATCCAATTTACAACTCAAAGCTGGTTACCAGCCTGATTAACCACTTGATGCTTGATGGTAAGCGCGGGACCGCTTCTAAGATCCTCTACCAAGCCCTTGACCAAATCAAGGAACAAACTGGTAACGACCCGATCGAAGTGTTCGAACAAGCAATGGAAAACATCAAGCCGGCCCTTGAAGTTAAGGCGCGCCGGATTGGTGGTTCTAACTACCAAGTGCCGATCGAAGTTCGCCCAGACCGTCAACGGACGTTGGCACTTCGTTGGCTCGTGCAATACGCACGTCTTCGTGGGGAACACACGATGGTGGAACGTCTTTCTGGCGAAATCATCGATGCTTCCAACAACACTGGTGCTTCCATCAAGAAGAAGGAAGACACCCTGCGGATGGCCGAAGCTAACCGGGCCTTCGCACACTACCGCTGGTAA

Protein sequence:

MPRKGHVAKPEVLPDPIYNSKLVTSLINHLMLDGKRGTASKILYQALDQIKEQTGNDPIEVFEQAMENIKPALEVKARRIGGSNYQVPIEVRPDRQRTLALRWLVQYARLRGEHTMVERLSGEIIDASNNTGASIKKKEDTLRMAEANRAFAHYRW

GenBank Info

gene - rpsG
locus_tag - FAM19471-i1-1.1_000225
inference - COORDINATES: similar to AA sequence:RefSeq:WP_013103428.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 30S ribosomal protein S7
protein_id - extdb:FAM19471-i1-1.1_000225

Gene Locus

Located on scaffold FAM19471-i1-1_scf2

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
FAM19471-i1-1.1_000224
FAM19471-i1-1.1_000226