update range to 10000 bp
locus tag: FAM19471-i1-1.1_000233 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
Gene Code
 rplV
Ortholog
 N0.HOG0001336 50S ribosomal protein L22
KEGG gene
 K02890 RP-L22, MRPL22, rplV; large subunit ribosomal protein L22 kornec03010
Gene Ontology
 GO:1990904 ribonucleoprotein complex
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044446 obsolete intracellular organelle part
Gene Ontology
 GO:0044445 obsolete cytosolic part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044422 obsolete organelle part
Gene Ontology
 GO:0044391 ribosomal subunit
Gene Ontology
 GO:0043232 intracellular non-membrane-bounded organelle
Gene Ontology
 GO:0043229 intracellular organelle
Gene Ontology
 GO:0043228 non-membrane-bounded organelle
Gene Ontology
 GO:0043226 organelle
Gene Ontology
 GO:0032991 protein-containing complex
Gene Ontology
 GO:0022626 cytosolic ribosome
Gene Ontology
 GO:0022625 cytosolic large ribosomal subunit
Gene Ontology
 GO:0015934 large ribosomal subunit
Gene Ontology
 GO:0005840 ribosome
Gene Ontology
 GO:0005829 cytosol
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005198 structural molecule activity
Gene Ontology
 GO:0003735 structural constituent of ribosome
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:rplV
Eggnog Ortholog
 EO:COG0091
Eggnog Description
 ED:The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit
Gene Product
 50S ribosomal protein L22

Occurs in the following pathway maps:

Pathway Description
kornec03010 Ribosome

Sequences

Nucleotide sequence (GC-content: 48.3 %):

ATGGCTGAAAACGTTACTTCAGCTAAGGCAACTGCTAAGATGGTCCGTGTATCATCTCGCAAGGTACGCCTGGTGCTTGACACCATCCGTAACAAGTCCGTTGCCGAAGCATTTGCTATTCTGAAGTTCACTCCAAACGGGGCTGCTTCAGACGTCGAAAAAGTTTTGAAATCTGCTGTTGCAAACGCTGAAAACAACTTTGACCTGGACCAAGCATCCTTGGTTGTAAGCGAAGCCTTTGCTAACGAAGGACCAACCTTAAAGCGGTTCCGTCCACGCGCCAAGGGTTCTGCTTCTCCAATTAACAAGCGGACCAGTCACATCACAGTGGTTGTTGCAGAAAAGTAG

Protein sequence:

MAENVTSAKATAKMVRVSSRKVRLVLDTIRNKSVAEAFAILKFTPNGAASDVEKVLKSAVANAENNFDLDQASLVVSEAFANEGPTLKRFRPRAKGSASPINKRTSHITVVVAEK

GenBank Info

gene - rplV
locus_tag - FAM19471-i1-1.1_000233
inference - COORDINATES: similar to AA sequence:RefSeq:WP_007207624.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 50S ribosomal protein L22
protein_id - extdb:FAM19471-i1-1.1_000233

Gene Locus

Located on scaffold FAM19471-i1-1_scf2

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
FAM19471-i1-1.1_000232
FAM19471-i1-1.1_000234