Annotations

Type Name Description Pathways
Gene Product
translation initiation factor IF-1
Ortholog
N0.HOG0001320 translation initiation factor IF-1
KEGG gene
K02518 infA; translation initiation factor IF-1
Gene Code
infA
Gene Ontology
GO:2001065 mannan binding
Gene Ontology
GO:0044877 protein-containing complex binding
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044444 obsolete cytoplasmic part
Gene Ontology
GO:0044424 obsolete intracellular part
Gene Ontology
GO:0043022 ribosome binding
Gene Ontology
GO:0043021 ribonucleoprotein complex binding
Gene Ontology
GO:0030247 polysaccharide binding
Gene Ontology
GO:0030246 carbohydrate binding
Gene Ontology
GO:0009986 cell surface
Gene Ontology
GO:0005829 cytosol
Gene Ontology
GO:0005737 cytoplasm
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005622 intracellular anatomical structure
Gene Ontology
GO:0005575 cellular_component
Gene Ontology
GO:0005488 binding
Gene Ontology
GO:0003674 molecular_function
Gene Ontology
GO:0001871 obsolete pattern binding
Eggnog Protein
EP:infA
Eggnog Ortholog
EO:COG0361
Eggnog Description
ED:One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl-tRNA(fMet) subsequently binds. Helps modulate mRNA selection

Sequences

Nucleotide sequence (GC-content: 46.6 %):

GTGGCAAAGGCCGATGTTATCGAAGTCGAGGGTAAGGTTACTGAAACCTTACCGAGCGCAATGTTTAAAGTTGAATTGGAAAATGGGGTTGAAATTCTGGCCCACGTTTCCGGTAAGATTCGGATGCACTACATCAAGATTTTACCTGGGGACCGGGTTCGGGTGGAAATGTCTCCATATGATCTGACCAAGGGCCGGATTACTTTCCGCTTCAAATAA

Protein sequence:

MAKADVIEVEGKVTETLPSAMFKVELENGVEILAHVSGKIRMHYIKILPGDRVRVEMSPYDLTKGRITFRFK

GenBank Info

gene - infA
locus_tag - FAM19471-i1-1.1_000250
inference - COORDINATES: similar to AA sequence:RefSeq:WP_009166687.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - translation initiation factor IF-1
protein_id - extdb:FAM19471-i1-1.1_000250

Gene Locus

Located on scaffold FAM19471-i1-1_scf2


Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
SL-0310: GO:0009986 cell surface

FAM19471-i1-1.1_000249
FAM19471-i1-1.1_000251