update range to 10000 bp
locus tag: FAM19471-i1-1.1_000308 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
Ortholog
 N0.HOG0000692 acyl carrier protein
KEGG gene
 K02078 acpP; acyl carrier protein kornec00998kornec01100kornec01110
Gene Ontology
 GO:1903509 liposaccharide metabolic process
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901271 lipooligosaccharide biosynthetic process
Gene Ontology
 GO:1901269 lipooligosaccharide metabolic process
Gene Ontology
 GO:1901137 carbohydrate derivative biosynthetic process
Gene Ontology
 GO:1901135 carbohydrate derivative metabolic process
Gene Ontology
 GO:0140104 molecular carrier activity
Gene Ontology
 GO:0090407 organophosphate biosynthetic process
Gene Ontology
 GO:0072341 modified amino acid binding
Gene Ontology
 GO:0072330 monocarboxylic acid biosynthetic process
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0051192 prosthetic group binding
Gene Ontology
 GO:0048037 obsolete cofactor binding
Gene Ontology
 GO:0046493 lipid A metabolic process
Gene Ontology
 GO:0046467 membrane lipid biosynthetic process
Gene Ontology
 GO:0046394 carboxylic acid biosynthetic process
Gene Ontology
 GO:0044620 ACP phosphopantetheine attachment site binding
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044283 small molecule biosynthetic process
Gene Ontology
 GO:0044281 small molecule metabolic process
Gene Ontology
 GO:0044255 cellular lipid metabolic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0043436 oxoacid metabolic process
Gene Ontology
 GO:0043168 anion binding
Gene Ontology
 GO:0043167 ion binding
Gene Ontology
 GO:0036094 small molecule binding
Gene Ontology
 GO:0033218 amide binding
Gene Ontology
 GO:0032787 monocarboxylic acid metabolic process
Gene Ontology
 GO:0031177 phosphopantetheine binding
Gene Ontology
 GO:0019842 vitamin binding
Gene Ontology
 GO:0019752 carboxylic acid metabolic process
Gene Ontology
 GO:0019637 organophosphate metabolic process
Gene Ontology
 GO:0016053 organic acid biosynthetic process
Gene Ontology
 GO:0016051 carbohydrate biosynthetic process
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009312 oligosaccharide biosynthetic process
Gene Ontology
 GO:0009311 oligosaccharide metabolic process
Gene Ontology
 GO:0009247 glycolipid biosynthetic process
Gene Ontology
 GO:0009245 lipid A biosynthetic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0008654 phospholipid biosynthetic process
Gene Ontology
 GO:0008610 lipid biosynthetic process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006796 phosphate-containing compound metabolic process
Gene Ontology
 GO:0006793 phosphorus metabolic process
Gene Ontology
 GO:0006664 glycolipid metabolic process
Gene Ontology
 GO:0006644 phospholipid metabolic process
Gene Ontology
 GO:0006643 membrane lipid metabolic process
Gene Ontology
 GO:0006633 fatty acid biosynthetic process
Gene Ontology
 GO:0006631 fatty acid metabolic process
Gene Ontology
 GO:0006629 lipid metabolic process
Gene Ontology
 GO:0006082 organic acid metabolic process
Gene Ontology
 GO:0005975 carbohydrate metabolic process
Gene Ontology
 GO:0005829 cytosol
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005488 binding
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0000036 acyl carrier activity
Gene Ontology
 GO:0000035 acyl binding
Eggnog Protein
 EP:acpP
Eggnog Ortholog
 EO:COG0236
Eggnog Description
 ED:Carrier of the growing fatty acid chain in fatty acid biosynthesis
Gene Product
 acyl carrier protein

Occurs in the following pathway maps:

Pathway Description
kornec00998 Biosynthesis of various secondary metabolites - part 2
kornec01100 Metabolic pathways
kornec01110 Biosynthesis of secondary metabolites

Sequences

Nucleotide sequence (GC-content: 44.6 %):

ATGACTAAGGAAGAAGTATTTGAAACTGTTAAGAACGTTGTTGTTGAAGAATTGGACGTTGACGAAGACCAAGTAACCTTGGACGCTAAGATCAAGGACGACCTGGAAGCCGACAGCCTGGACGTGTTTGAAATCATGAACGAACTGGAAGACAAGTTCGACATCCAATTAGACGTTGAAGAAGGGATCGAAACGATCGGCGACGTGGTTGACTTTGTTAAGAAGCAACTGGACGAAAAGGACGCCTAA

Protein sequence:

MTKEEVFETVKNVVVEELDVDEDQVTLDAKIKDDLEADSLDVFEIMNELEDKFDIQLDVEEGIETIGDVVDFVKKQLDEKDA

GenBank Info

locus_tag - FAM19471-i1-1.1_000308
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003682540.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - acyl carrier protein
protein_id - extdb:FAM19471-i1-1.1_000308

Gene Locus

Located on scaffold FAM19471-i1-1_scf3

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
FAM19471-i1-1.1_000307
FAM19471-i1-1.1_000309