update range to 10000 bp
locus tag: FAM19471-i1-1.1_000370 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
Ortholog
 N0.HOG0001398 D-tyrosyl-tRNA(Tyr) deacylase
KEGG gene
 K07560 dtd, DTD; D-aminoacyl-tRNA deacylase [EC:3.1.1.96]
Gene Ontology
 GO:1901360 organic cyclic compound metabolic process
Gene Ontology
 GO:0140101 catalytic activity, acting on a tRNA
Gene Ontology
 GO:0140098 catalytic activity, acting on RNA
Gene Ontology
 GO:0106074 aminoacyl-tRNA metabolism involved in translational fidelity
Gene Ontology
 GO:0090304 nucleic acid metabolic process
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0065008 regulation of biological quality
Gene Ontology
 GO:0065007 biological regulation
Gene Ontology
 GO:0052689 carboxylic ester hydrolase activity
Gene Ontology
 GO:0051500 D-tyrosyl-tRNA(Tyr) deacylase activity
Gene Ontology
 GO:0051499 D-aminoacyl-tRNA deacylase activity
Gene Ontology
 GO:0046483 heterocycle metabolic process
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0043170 macromolecule metabolic process
Gene Ontology
 GO:0034660 ncRNA metabolic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0016788 hydrolase activity, acting on ester bonds
Gene Ontology
 GO:0016787 hydrolase activity
Gene Ontology
 GO:0016070 RNA metabolic process
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
 GO:0006450 regulation of translational fidelity
Gene Ontology
 GO:0006399 tRNA metabolic process
Gene Ontology
 GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0002161 aminoacyl-tRNA editing activity
Eggnog Protein
 EP:dtd
Eggnog Ortholog
 EO:COG1490
Eggnog Description
 ED:rejects L-amino acids rather than detecting D-amino acids in the active site. By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules
EC Number
 EC:3.1.1.96 D-aminoacyl-tRNA deacylase; Dtd2; D-Tyr-tRNA(Tyr) deacylase; D-Tyr-tRNATyr deacylase; D-tyrosyl-tRNATyr aminoacylhydrolase; dtdA (gene name)
Gene Product
 D-tyrosyl-tRNA(Tyr) deacylase

Sequences

Nucleotide sequence (GC-content: 56.6 %):

ATGCGTGTAGTATTGCAACGGGTTAAGGAAGCAAGCGTCACCATCGAAGGGCAAGTCGTCGGCCAAATTGGTCAGGGCTACTTGCTGTTGGTCGGCTTTGGTCCCGATGACACCGAAGAGACGCTAGATTACATGGTCCACAAGATTACCAACCTGCGGGTCTTTGAGAGCGAACCAGGCAAGATGAACCTGGGCTTAAAGGACGTTGACGGCGCTATCTTGTCGGTCTCGCAGTTTACCCTGTACGCCGACGTTAAGCACGGCAACCGGCCGGGCTTTTCCAACGCCGCCAAACCATCCTTAGCCGAACCCCTCTACCAGCGCTTTAACGAAAAACTGGCCGCCACCGGGATCCCGGTGGCGACCGGGCAGTTCGGCGCCGATATGCAGGTGGCCCTGGTCAACGATGGGCCGGTGACGATTTGGTATGAGAAGTAA

Protein sequence:

MRVVLQRVKEASVTIEGQVVGQIGQGYLLLVGFGPDDTEETLDYMVHKITNLRVFESEPGKMNLGLKDVDGAILSVSQFTLYADVKHGNRPGFSNAAKPSLAEPLYQRFNEKLAATGIPVATGQFGADMQVALVNDGPVTIWYEK

GenBank Info

locus_tag - FAM19471-i1-1.1_000370
EC_number - 3.1.1.96
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003681786.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - D-tyrosyl-tRNA(Tyr) deacylase
protein_id - extdb:FAM19471-i1-1.1_000370

Gene Locus

Located on scaffold FAM19471-i1-1_scf4

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
FAM19471-i1-1.1_000369
FAM19471-i1-1.1_000371