update range to 10000 bp
locus tag: FAM19471-i1-1.1_000396 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
Ortholog
 N0.HOG0003436 30S ribosomal protein S21
KEGG gene
 K02970 RP-S21, MRPS21, rpsU; small subunit ribosomal protein S21 kornec03010
Gene Ontology
 GO:1990904 ribonucleoprotein complex
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044446 obsolete intracellular organelle part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044422 obsolete organelle part
Gene Ontology
 GO:0044391 ribosomal subunit
Gene Ontology
 GO:0043232 intracellular non-membrane-bounded organelle
Gene Ontology
 GO:0043229 intracellular organelle
Gene Ontology
 GO:0043228 non-membrane-bounded organelle
Gene Ontology
 GO:0043226 organelle
Gene Ontology
 GO:0032991 protein-containing complex
Gene Ontology
 GO:0005840 ribosome
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Eggnog Protein
 EP:rpsU
Eggnog Ortholog
 EO:COG0828
Eggnog Description
 ED:Belongs to the bacterial ribosomal protein bS21 family
Gene Product
 30S ribosomal protein S21

Occurs in the following pathway maps:

Pathway Description
kornec03010 Ribosome

Sequences

Nucleotide sequence (GC-content: 46.0 %):

ATGTCAAAAACTATCGTTCGTAAGAATGAATCGTTAGACGATGCTCTTCGGCGCTTTAAGCGTACCGTTTCACGTAACGGGACTCTGCAAGAATACCGCAAGCGTGAATTTTACGAAAAGCCAAGTGTTAAGCGTAAGTTAAAGTCTGAAGCGGCACGGAAGCGCAAGAACAAGCGCCGTCGTTACTAG

Protein sequence:

MSKTIVRKNESLDDALRRFKRTVSRNGTLQEYRKREFYEKPSVKRKLKSEAARKRKNKRRRY

GenBank Info

locus_tag - FAM19471-i1-1.1_000396
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003665847.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 30S ribosomal protein S21
protein_id - extdb:FAM19471-i1-1.1_000396

Gene Locus

Located on scaffold FAM19471-i1-1_scf4

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
FAM19471-i1-1.1_000395
FAM19471-i1-1.1_000397