update range to 10000 bp
locus tag: FAM19471-i1-1.1_000552 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
Ortholog
 N0.HOG0003477 adaptor protein MecA
KEGG gene
 K16511 mecA1_2; adapter protein MecA 1/2
Gene Ontology
 GO:2001141 regulation of RNA biosynthetic process
Gene Ontology
 GO:2000113 negative regulation of cellular macromolecule biosynthetic process
Gene Ontology
 GO:2000112 regulation of cellular macromolecule biosynthetic process
Gene Ontology
 GO:1903507 negative regulation of nucleic acid-templated transcription
Gene Ontology
 GO:1903506 regulation of nucleic acid-templated transcription
Gene Ontology
 GO:1902679 negative regulation of RNA biosynthetic process
Gene Ontology
 GO:0080090 regulation of primary metabolic process
Gene Ontology
 GO:0065007 biological regulation
Gene Ontology
 GO:0060255 regulation of macromolecule metabolic process
Gene Ontology
 GO:0051253 negative regulation of RNA metabolic process
Gene Ontology
 GO:0051252 regulation of RNA metabolic process
Gene Ontology
 GO:0051172 negative regulation of nitrogen compound metabolic process
Gene Ontology
 GO:0051171 regulation of nitrogen compound metabolic process
Gene Ontology
 GO:0050794 regulation of cellular process
Gene Ontology
 GO:0050789 regulation of biological process
Gene Ontology
 GO:0048523 negative regulation of cellular process
Gene Ontology
 GO:0048519 negative regulation of biological process
Gene Ontology
 GO:0045934 negative regulation of nucleobase-containing compound metabolic process
Gene Ontology
 GO:0045892 negative regulation of DNA-templated transcription
Gene Ontology
 GO:0031327 negative regulation of cellular biosynthetic process
Gene Ontology
 GO:0031326 regulation of cellular biosynthetic process
Gene Ontology
 GO:0031324 negative regulation of cellular metabolic process
Gene Ontology
 GO:0031323 regulation of cellular metabolic process
Gene Ontology
 GO:0019222 regulation of metabolic process
Gene Ontology
 GO:0019219 regulation of nucleobase-containing compound metabolic process
Gene Ontology
 GO:0010629 negative regulation of gene expression
Gene Ontology
 GO:0010605 negative regulation of macromolecule metabolic process
Gene Ontology
 GO:0010558 negative regulation of macromolecule biosynthetic process
Gene Ontology
 GO:0010556 regulation of macromolecule biosynthetic process
Gene Ontology
 GO:0010468 regulation of gene expression
Gene Ontology
 GO:0009892 negative regulation of metabolic process
Gene Ontology
 GO:0009890 negative regulation of biosynthetic process
Gene Ontology
 GO:0009889 regulation of biosynthetic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006355 regulation of DNA-templated transcription
Eggnog Protein
 EP:mecA
Eggnog Ortholog
 EO:COG4862
Eggnog Description
 ED:Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis
Gene Product
 competence protein

Sequences

Nucleotide sequence (GC-content: 47.8 %):

ATGAAAGTTAAAAGAATCAATGATTACACGCTCCAAGTGATGCTCCAAAAGGATGAGTTGACCGAGCGGGGCATTGGTATGATGGATTTGATGGGGAACCAACAGCAAATGGAAGACTTTTTCCAGACCGTGTTAGACGAGGTAGACCCTCAGCATCAATTTTCGATGGATCAAACGGTGCTGTTTCAGGTGATGCCAACTAACGACGGAATCCAGTTAACGATTACTAAGCACGATGGCGACGTTACCGACCAAGACGTCCAAGAACAAGCCGCTGAAAATATCTCCCGGTTCTTACAAAATGAACTACGGGGGCACGATTTCGATAAGAATGACCAGCGAAGCCACGGGGCTGATGCGAGTGAACAAACTCACGATGATGCCGATGAGATTGCCGCGGCCTTAAATGACCCTGACGTTAAAAAATATACCCGGGTGGTGAAGTTTGATTCCTTTGAAGACTTCGTCGCCCTTGCCAAGGTGATTGATACCAGTAACATGGCGGCGGACTTATACCAAGAAGACCACCATTACATTTTGGTGGTGACCTTCTTTGAAAACGGCGAACTTTCGCCGGAAAGTGTAAAGGATCGCTTAGCCGTCATTTACGAATACGCTTCGCCAAGTAAATTGGAAGCCATGGTAGTTGCTGAACACGGCCACCGGGTGATGGAGCACGCCGCCTTTGAATTGGCACGCCACTACTTCAGTTAA

Protein sequence:

MKVKRINDYTLQVMLQKDELTERGIGMMDLMGNQQQMEDFFQTVLDEVDPQHQFSMDQTVLFQVMPTNDGIQLTITKHDGDVTDQDVQEQAAENISRFLQNELRGHDFDKNDQRSHGADASEQTHDDADEIAAALNDPDVKKYTRVVKFDSFEDFVALAKVIDTSNMAADLYQEDHHYILVVTFFENGELSPESVKDRLAVIYEYASPSKLEAMVVAEHGHRVMEHAAFELARHYFS

GenBank Info

locus_tag - FAM19471-i1-1.1_000552
inference - COORDINATES: similar to AA sequence:RefSeq:WP_015638722.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - competence protein
protein_id - extdb:FAM19471-i1-1.1_000552

Gene Locus

Located on scaffold FAM19471-i1-1_scf7

FAM19471-i1-1.1_000551
FAM19471-i1-1.1_000553