update range to 10000 bp
locus tag: FAM19471-i1-1.1_000595 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
Gene Product
 peptide deformylase
Ortholog
 N0.HOG0001263 peptide deformylase
KEGG gene
 K01462 PDF, def; peptide deformylase [EC:3.5.1.88]
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0044267 -
Gene Ontology
 GO:0044260 cellular macromolecule metabolic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0043686 co-translational protein modification
Gene Ontology
 GO:0043412 macromolecule modification
Gene Ontology
 GO:0043170 macromolecule metabolic process
Gene Ontology
 GO:0042586 peptide deformylase activity
Gene Ontology
 GO:0036211 protein modification process
Gene Ontology
 GO:0031365 N-terminal protein amino acid modification
Gene Ontology
 GO:0019538 protein metabolic process
Gene Ontology
 GO:0018206 peptidyl-methionine modification
Gene Ontology
 GO:0018193 peptidyl-amino acid modification
Gene Ontology
 GO:0016811 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides
Gene Ontology
 GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Gene Ontology
 GO:0016787 hydrolase activity
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006464 -
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:def
Eggnog Ortholog
 EO:COG0242
Eggnog Description
 ED:Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions
EC Number
 EC:3.5.1.88 peptide deformylase; N-formylmethionylaminoacyl-tRNA deformylase

Sequences

Nucleotide sequence (GC-content: 54.4 %):

ATGATTTTAATGAAAGACATTGTCAGAGACGACCAGGAGGGAACGGTCCTGCGCGATTACGCCGCCAAGGTGTCCTTCCCACTGACCGAAGAAGAACAACAATTGGCTAAGGACCTAATGGAATACTTGGAAATCAGCCAAGATGAAGAACTGGCCGAAAAGTACGGGTTGCGGGCCGGGGTTGGCCTTGCCGCTCCCCAGGTCAACGTCAGCAAGCAAATGGCCGCCGTCTTGGTGCCATCCGACGACGAAGAAGACGACACCCCGATTTTTAAGGATGTGATCATCAACCCGGTCATCATTTCCGAATCCGTACAAATGGGGGCGCTAACGGAAGGCGAAGGCTGCCTCTCCGTTGATCGCGACATCGCCGGCTACGTGCCACGTCACGACCGGATCACCCTCAAGTACCAAGACGTCCAGGGTGAAACGCACAAGGTCCGCTTAAAGCACTACCCCGCCATCGTTTGCCAACACGAAATTGACCACCTCCACGGGGTGCTGTTCTACGATCACATTAACAAGGACAACCCGTTTGAGGCCCCCGAAGGAACCGTCTTCTTCGGTTAA

Protein sequence:

MILMKDIVRDDQEGTVLRDYAAKVSFPLTEEEQQLAKDLMEYLEISQDEELAEKYGLRAGVGLAAPQVNVSKQMAAVLVPSDDEEDDTPIFKDVIINPVIISESVQMGALTEGEGCLSVDRDIAGYVPRHDRITLKYQDVQGETHKVRLKHYPAIVCQHEIDHLHGVLFYDHINKDNPFEAPEGTVFFG

GenBank Info

locus_tag - FAM19471-i1-1.1_000595
EC_number - 3.5.1.88
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003682096.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - peptide deformylase
protein_id - extdb:FAM19471-i1-1.1_000595

Gene Locus

Located on scaffold FAM19471-i1-1_scf7

FAM19471-i1-1.1_000594
FAM19471-i1-1.1_000596