Annotations

Type Name Description Pathways
Ortholog
N0.HOG0001461 F0F1 ATP synthase subunit A
KEGG gene
K02108 ATPF0A, atpB; F-type H+-transporting ATPase subunit a kornec00190kornec00195kornec01100
Gene Ontology
GO:1902600 proton transmembrane transport
Gene Ontology
GO:1901576 organic substance biosynthetic process
Gene Ontology
GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
GO:1901564 organonitrogen compound metabolic process
Gene Ontology
GO:1901362 organic cyclic compound biosynthetic process
Gene Ontology
GO:1901360 organic cyclic compound metabolic process
Gene Ontology
GO:1901293 nucleoside phosphate biosynthetic process
Gene Ontology
GO:1901137 carbohydrate derivative biosynthetic process
Gene Ontology
GO:1901135 carbohydrate derivative metabolic process
Gene Ontology
GO:0099132 -
Gene Ontology
GO:0099131 -
Gene Ontology
GO:0098796 membrane protein complex
Gene Ontology
GO:0098662 inorganic cation transmembrane transport
Gene Ontology
GO:0098660 inorganic ion transmembrane transport
Gene Ontology
GO:0098655 cation transmembrane transport
Gene Ontology
GO:0090662 -
Gene Ontology
GO:0090407 organophosphate biosynthetic process
Gene Ontology
GO:0072522 purine-containing compound biosynthetic process
Gene Ontology
GO:0072521 purine-containing compound metabolic process
Gene Ontology
GO:0071944 cell periphery
Gene Ontology
GO:0071704 organic substance metabolic process
Gene Ontology
GO:0055086 nucleobase-containing small molecule metabolic process
Gene Ontology
GO:0055085 transmembrane transport
Gene Ontology
GO:0051234 establishment of localization
Gene Ontology
GO:0051179 localization
Gene Ontology
GO:0046933 proton-transporting ATP synthase activity, rotational mechanism
Gene Ontology
GO:0046483 heterocycle metabolic process
Gene Ontology
GO:0046390 ribose phosphate biosynthetic process
Gene Ontology
GO:0046034 ATP metabolic process
Gene Ontology
GO:0045263 proton-transporting ATP synthase complex, coupling factor F(o)
Gene Ontology
GO:0045259 proton-transporting ATP synthase complex
Gene Ontology
GO:0044769 ATPase activity, coupled to transmembrane movement of ions, rotational mechanism
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044459 obsolete plasma membrane part
Gene Ontology
GO:0044425 obsolete membrane part
Gene Ontology
GO:0044424 obsolete intracellular part
Gene Ontology
GO:0044281 small molecule metabolic process
Gene Ontology
GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
GO:0044249 cellular biosynthetic process
Gene Ontology
GO:0044238 primary metabolic process
Gene Ontology
GO:0044237 cellular metabolic process
Gene Ontology
GO:0043492 -
Gene Ontology
GO:0042777 proton motive force-driven plasma membrane ATP synthesis
Gene Ontology
GO:0042626 ATPase-coupled transmembrane transporter activity
Gene Ontology
GO:0042625 ATPase-coupled ion transmembrane transporter activity
Gene Ontology
GO:0042623 -
Gene Ontology
GO:0034654 nucleobase-containing compound biosynthetic process
Gene Ontology
GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
GO:0034220 ion transmembrane transport
Gene Ontology
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain
Gene Ontology
GO:0032991 protein-containing complex
Gene Ontology
GO:0031226 intrinsic component of plasma membrane
Gene Ontology
GO:0031224 intrinsic component of membrane
Gene Ontology
GO:0022890 inorganic cation transmembrane transporter activity
Gene Ontology
GO:0022857 transmembrane transporter activity
Gene Ontology
GO:0022853 active ion transmembrane transporter activity
Gene Ontology
GO:0022804 active transmembrane transporter activity
Gene Ontology
GO:0019829 ATPase-coupled cation transmembrane transporter activity
Gene Ontology
GO:0019693 ribose phosphate metabolic process
Gene Ontology
GO:0019637 organophosphate metabolic process
Gene Ontology
GO:0019438 aromatic compound biosynthetic process
Gene Ontology
GO:0018130 heterocycle biosynthetic process
Gene Ontology
GO:0017144 -
Gene Ontology
GO:0017111 ribonucleoside triphosphate phosphatase activity
Gene Ontology
GO:0016887 ATP hydrolysis activity
Gene Ontology
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
Gene Ontology
GO:0016817 hydrolase activity, acting on acid anhydrides
Gene Ontology
GO:0016787 hydrolase activity
Gene Ontology
GO:0016469 proton-transporting two-sector ATPase complex
Gene Ontology
GO:0016462 pyrophosphatase activity
Gene Ontology
GO:0016021 integral component of membrane
Gene Ontology
GO:0016020 membrane
Gene Ontology
GO:0015986 proton motive force-driven ATP synthesis
Gene Ontology
GO:0015985 energy coupled proton transport, down electrochemical gradient
Gene Ontology
GO:0015672 -
Gene Ontology
GO:0015405 -
Gene Ontology
GO:0015399 primary active transmembrane transporter activity
Gene Ontology
GO:0015318 inorganic molecular entity transmembrane transporter activity
Gene Ontology
GO:0015078 proton transmembrane transporter activity
Gene Ontology
GO:0015077 -
Gene Ontology
GO:0015075 ion transmembrane transporter activity
Gene Ontology
GO:0009987 cellular process
Gene Ontology
GO:0009260 ribonucleotide biosynthetic process
Gene Ontology
GO:0009259 ribonucleotide metabolic process
Gene Ontology
GO:0009206 purine ribonucleoside triphosphate biosynthetic process
Gene Ontology
GO:0009205 purine ribonucleoside triphosphate metabolic process
Gene Ontology
GO:0009201 ribonucleoside triphosphate biosynthetic process
Gene Ontology
GO:0009199 ribonucleoside triphosphate metabolic process
Gene Ontology
GO:0009168 purine ribonucleoside monophosphate biosynthetic process
Gene Ontology
GO:0009167 purine ribonucleoside monophosphate metabolic process
Gene Ontology
GO:0009165 nucleotide biosynthetic process
Gene Ontology
GO:0009161 ribonucleoside monophosphate metabolic process
Gene Ontology
GO:0009156 ribonucleoside monophosphate biosynthetic process
Gene Ontology
GO:0009152 purine ribonucleotide biosynthetic process
Gene Ontology
GO:0009150 purine ribonucleotide metabolic process
Gene Ontology
GO:0009145 purine nucleoside triphosphate biosynthetic process
Gene Ontology
GO:0009144 purine nucleoside triphosphate metabolic process
Gene Ontology
GO:0009142 nucleoside triphosphate biosynthetic process
Gene Ontology
GO:0009141 nucleoside triphosphate metabolic process
Gene Ontology
GO:0009127 purine nucleoside monophosphate biosynthetic process
Gene Ontology
GO:0009126 purine nucleoside monophosphate metabolic process
Gene Ontology
GO:0009124 nucleoside monophosphate biosynthetic process
Gene Ontology
GO:0009123 nucleoside monophosphate metabolic process
Gene Ontology
GO:0009117 nucleotide metabolic process
Gene Ontology
GO:0009058 biosynthetic process
Gene Ontology
GO:0008324 cation transmembrane transporter activity
Gene Ontology
GO:0008152 metabolic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0006812 cation transport
Gene Ontology
GO:0006811 ion transport
Gene Ontology
GO:0006810 transport
Gene Ontology
GO:0006807 nitrogen compound metabolic process
Gene Ontology
GO:0006796 phosphate-containing compound metabolic process
Gene Ontology
GO:0006793 phosphorus metabolic process
Gene Ontology
GO:0006754 ATP biosynthetic process
Gene Ontology
GO:0006753 nucleoside phosphate metabolic process
Gene Ontology
GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
GO:0006164 purine nucleotide biosynthetic process
Gene Ontology
GO:0006163 purine nucleotide metabolic process
Gene Ontology
GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
GO:0005887 integral component of plasma membrane
Gene Ontology
GO:0005886 plasma membrane
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005622 intracellular anatomical structure
Gene Ontology
GO:0005575 cellular_component
Gene Ontology
GO:0005215 transporter activity
Gene Ontology
GO:0003824 catalytic activity
Gene Ontology
GO:0003674 molecular_function
Gene Product
F0F1 ATP synthase subunit A
Eggnog Protein
EP:atpB
Eggnog Ortholog
EO:COG0356
Eggnog Description
ED:it plays a direct role in the translocation of protons across the membrane
EC Number
EC:7.1.2.2 H+-transporting two-sector ATPase; ATP synthase; F1-ATPase; FoF1-ATPase; H+-transporting ATPase; mitochondrial ATPase; coupling factors (Fo, F1 and CF1); chloroplast ATPase; bacterial Ca2+/Mg2+ ATPase kornec00190kornec00195kornec01100
Gene Code
atpB

Occurs in the following pathway maps:

Pathway Description
kornec00190 Oxidative phosphorylation
kornec00195 Photosynthesis
kornec01100 Metabolic pathways

Sequences

Nucleotide sequence (GC-content: 45.7 %):

ATGGGCGGTGATGCGTTCACTTTTGAACTATTCGGCCTGACCTTCAACTGGACCAACTTGATCTCCGGTACGATCGTCTTCGTCATTACCTTCTTCCTGTTATTTGGGTTGTCAAGGCACCTGCAGATGAAGCCAACCGGTGGCCAAAACGTCTTGGAATGGATCGTGGAATTTACGAACGGGATTGTGCGTGGACAAATGCCTTCAGAAACGAGTGGTTTTTACAGTTTCTTTGTATTTGTCTTGTTCGTCTTCCTTTTCATTTCCAACCAACTTGGTTTGATCATTCAGTTCGGCTGGAACGGGCATGAAATTGTCAAAAGTCCAACCGCAGATCCGGTAGTTACCATGACGCTTGCCTTGTGTGCCGTTACGCTGTCACACTTTGCGGGGGTCGCTCGACAAGGCGTTAAGGGTTACTTTGCGGACTACTTCAAGCCATTCTCACTTATGTTTCCAATTAAGTTGGTTGAAGAGTTTAGTAACTTCCTAACCTTAGGGCTGCGGATCTTTGGTAATATTTATGCCGGTGAATTACTGTTGAAATTACTTGCTGGAATGGCGTTCTCTCACGGGATTCCTACGATGATCGTGAGCCTGCCACTAGAAATTATTTGGCAAGGCTTCTCAGTCTTCATCGGGGCCATTCAGGCTTATGTCTTTGTAACATTAACGACGGTTTATATTTCTCGGAAGGTAACCGGGGAATAA

Protein sequence:

MGGDAFTFELFGLTFNWTNLISGTIVFVITFFLLFGLSRHLQMKPTGGQNVLEWIVEFTNGIVRGQMPSETSGFYSFFVFVLFVFLFISNQLGLIIQFGWNGHEIVKSPTADPVVTMTLALCAVTLSHFAGVARQGVKGYFADYFKPFSLMFPIKLVEEFSNFLTLGLRIFGNIYAGELLLKLLAGMAFSHGIPTMIVSLPLEIIWQGFSVFIGAIQAYVFVTLTTVYISRKVTGE

GenBank Info

gene - atpB
locus_tag - FAM19471-i1-1.1_000707
EC_number - 7.1.2.2
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003682740.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - F0F1 ATP synthase subunit A
protein_id - extdb:FAM19471-i1-1.1_000707

Gene Locus

Located on scaffold FAM19471-i1-1_scf9


Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0039: GO:0005886 plasma membrane
SL-0162: GO:0016020 membrane

FAM19471-i1-1.1_000706
FAM19471-i1-1.1_000708