update range to 10000 bp
locus tag: FAM19471-i1-1.1_000831 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
Gene Product
 transcriptional repressor LexA
Ortholog
 N0.HOG0001390 transcriptional repressor LexA
Gene Code
 lexA
KEGG gene
 K01356 lexA; repressor LexA [EC:3.4.21.88]
Gene Ontology
 GO:2001141 regulation of RNA biosynthetic process
Gene Ontology
 GO:2000113 negative regulation of cellular macromolecule biosynthetic process
Gene Ontology
 GO:2000112 regulation of cellular macromolecule biosynthetic process
Gene Ontology
 GO:1990837 sequence-specific double-stranded DNA binding
Gene Ontology
 GO:1903507 negative regulation of nucleic acid-templated transcription
Gene Ontology
 GO:1903506 regulation of nucleic acid-templated transcription
Gene Ontology
 GO:1902679 negative regulation of RNA biosynthetic process
Gene Ontology
 GO:1901363 heterocyclic compound binding
Gene Ontology
 GO:0140110 transcription regulator activity
Gene Ontology
 GO:0097159 organic cyclic compound binding
Gene Ontology
 GO:0080090 regulation of primary metabolic process
Gene Ontology
 GO:0071496 cellular response to external stimulus
Gene Ontology
 GO:0065007 biological regulation
Gene Ontology
 GO:0060255 regulation of macromolecule metabolic process
Gene Ontology
 GO:0051716 cellular response to stimulus
Gene Ontology
 GO:0051253 negative regulation of RNA metabolic process
Gene Ontology
 GO:0051252 regulation of RNA metabolic process
Gene Ontology
 GO:0051172 negative regulation of nitrogen compound metabolic process
Gene Ontology
 GO:0051171 regulation of nitrogen compound metabolic process
Gene Ontology
 GO:0050896 response to stimulus
Gene Ontology
 GO:0050794 regulation of cellular process
Gene Ontology
 GO:0050789 regulation of biological process
Gene Ontology
 GO:0048523 negative regulation of cellular process
Gene Ontology
 GO:0048519 negative regulation of biological process
Gene Ontology
 GO:0045934 negative regulation of nucleobase-containing compound metabolic process
Gene Ontology
 GO:0045892 negative regulation of DNA-templated transcription
Gene Ontology
 GO:0044212 -
Gene Ontology
 GO:0043565 sequence-specific DNA binding
Gene Ontology
 GO:0033554 cellular response to stress
Gene Ontology
 GO:0032993 protein-DNA complex
Gene Ontology
 GO:0032991 protein-containing complex
Gene Ontology
 GO:0031668 cellular response to extracellular stimulus
Gene Ontology
 GO:0031327 negative regulation of cellular biosynthetic process
Gene Ontology
 GO:0031326 regulation of cellular biosynthetic process
Gene Ontology
 GO:0031324 negative regulation of cellular metabolic process
Gene Ontology
 GO:0031323 regulation of cellular metabolic process
Gene Ontology
 GO:0019222 regulation of metabolic process
Gene Ontology
 GO:0019219 regulation of nucleobase-containing compound metabolic process
Gene Ontology
 GO:0010629 negative regulation of gene expression
Gene Ontology
 GO:0010605 negative regulation of macromolecule metabolic process
Gene Ontology
 GO:0010558 negative regulation of macromolecule biosynthetic process
Gene Ontology
 GO:0010556 regulation of macromolecule biosynthetic process
Gene Ontology
 GO:0010468 regulation of gene expression
Gene Ontology
 GO:0009991 response to extracellular stimulus
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009892 negative regulation of metabolic process
Gene Ontology
 GO:0009890 negative regulation of biosynthetic process
Gene Ontology
 GO:0009889 regulation of biosynthetic process
Gene Ontology
 GO:0009605 response to external stimulus
Gene Ontology
 GO:0009432 SOS response
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0007154 cell communication
Gene Ontology
 GO:0006974 cellular response to DNA damage stimulus
Gene Ontology
 GO:0006950 response to stress
Gene Ontology
 GO:0006355 regulation of DNA-templated transcription
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005488 binding
Gene Ontology
 GO:0003700 DNA-binding transcription factor activity
Gene Ontology
 GO:0003690 double-stranded DNA binding
Gene Ontology
 GO:0003677 DNA binding
Gene Ontology
 GO:0003676 nucleic acid binding
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0001217 DNA-binding transcription repressor activity
Gene Ontology
 GO:0001130 -
Gene Ontology
 GO:0001067 transcription regulatory region nucleic acid binding
Gene Ontology
 GO:0000976 transcription cis-regulatory region binding
Eggnog Protein
 EP:lexA
Eggnog Ortholog
 EO:COG1974
Eggnog Description
 ED:Represses a number of genes involved in the response to DNA damage (SOS response)
EC Number
 EC:3.4.21.88 repressor LexA; LexA repressor

Sequences

Nucleotide sequence (GC-content: 56.1 %):

ATGCCAAGGAATTCCACCAACAAACAAATGGCCGTGCTCAGCTTCATTCATAAGCAAGTTGACGCCCACGGCTACCCGCCGACCGTGCGGGAAATCTGCGGGGCCGTGGGGCTCTCTTCCACGTCAACGGTCCACGGCCACATCAACCGCCTGATCAAAAAGGGCTACCTAAAAAAGGACCCGTCCAAGCCCCGGGCCCTGGAAATCACCCCGGCTGGGCTGGAAGTCCTGGGAATCACCCCTAAGCAAACCCAAATCCCCCTCCTGGGGGTGGTGGCCGCTGGGGAACCAATTCTTGCGGTCCAAGACGCCACCGATTTCTTCCCGATTCCGCCTTCGATCCCGGATCACGATGACTTGTTCATGCTGACCATTCAGGGGACGTCGATGATCAACATTGGGATCCTAAACGGCGACAAGGTGATCGTCCGCCGCCAGGAAACGGCCAATAACGGCGACATCGTGATCGCCATGACCAGCGATAACGAAGCGACTTGCAAGCGTTTCTTTAAGGAACAGGGCCACATCCGCTTGCAACCGGAAAACGACACGTTGGCCCCAATTATTTTGGACGACGTCACCATCCTCGGTAAGGTGGTCGGCCTCTTTCGGGATGATATTTTTTAA

Protein sequence:

MPRNSTNKQMAVLSFIHKQVDAHGYPPTVREICGAVGLSSTSTVHGHINRLIKKGYLKKDPSKPRALEITPAGLEVLGITPKQTQIPLLGVVAAGEPILAVQDATDFFPIPPSIPDHDDLFMLTIQGTSMINIGILNGDKVIVRRQETANNGDIVIAMTSDNEATCKRFFKEQGHIRLQPENDTLAPIILDDVTILGKVVGLFRDDIF

GenBank Info

gene - lexA
locus_tag - FAM19471-i1-1.1_000831
EC_number - 3.4.21.88
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003674334.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - transcriptional repressor LexA
protein_id - extdb:FAM19471-i1-1.1_000831

Gene Locus

Located on scaffold FAM19471-i1-1_scf12

FAM19471-i1-1.1_000830
FAM19471-i1-1.1_000832