Annotations

Type Name Description Pathways
Gene Product
response regulator transcription factor
Ortholog
N0.HOG0000067 response regulator transcription factor
KEGG gene
K07668 vicR; two-component system, OmpR family, response regulator VicR kornec02020
Gene Ontology
GO:2001141 regulation of RNA biosynthetic process
Gene Ontology
GO:2000112 regulation of cellular macromolecule biosynthetic process
Gene Ontology
GO:1903506 regulation of nucleic acid-templated transcription
Gene Ontology
GO:0080090 regulation of primary metabolic process
Gene Ontology
GO:0065007 biological regulation
Gene Ontology
GO:0060255 regulation of macromolecule metabolic process
Gene Ontology
GO:0051252 regulation of RNA metabolic process
Gene Ontology
GO:0051171 regulation of nitrogen compound metabolic process
Gene Ontology
GO:0050794 regulation of cellular process
Gene Ontology
GO:0050789 regulation of biological process
Gene Ontology
GO:0031326 regulation of cellular biosynthetic process
Gene Ontology
GO:0031323 regulation of cellular metabolic process
Gene Ontology
GO:0019222 regulation of metabolic process
Gene Ontology
GO:0019219 regulation of nucleobase-containing compound metabolic process
Gene Ontology
GO:0010556 regulation of macromolecule biosynthetic process
Gene Ontology
GO:0010468 regulation of gene expression
Gene Ontology
GO:0009889 regulation of biosynthetic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0006355 regulation of DNA-templated transcription
Eggnog Protein
EP:yycF
Eggnog Ortholog
EO:COG0745
Eggnog Description
ED:response regulator

Occurs in the following pathway maps:

Pathway Description
kornec02020 Two-component system

Sequences

Nucleotide sequence (GC-content: 54.8 %):

ATGGCCAAGAAAGTTTTGGTTATTGACGATGAAAAACCGATTTCGGATATCATTAAGTTTAACCTAGAAAAGGAGGGCTATGAAGTCGTCGTGGCTTACGACGGGGAAGAGGCCCTGCAAAAGGTCGAAAGCGAGTCACCGGATCTGATCGTCTTAGACCTGATGCTGCCCAAAATTGACGGCCTGGAAGTGGCTAAGCAGGTGCGGGCTAAGCGTTCGACGCCAATCATCATGGTAACGGCTAAGGATTCGGAACTCGATAAGGTTTTGGGCCTTGAGTTGGGGGCCGACGATTACGTTACCAAGCCGTTTTCTAACCGTGAGCTAGTGGCCCGGGTTAAGGCTAACCTGCGCCGCCAAGACGCCACCGTTTCACCGGCGAACGACGACCGGACCGCCGATATCAAGGTGGGGGATTTGACCATCCACCCGGACGCCTACACGGTCACCAAGCGGGGCGAAAACATCAACCTGACCCACCGGGAGTTCGAGCTCTTGCACTACCTCGCCCAACACATTGGCCAGGTCATCAACCGGGAGCACCTCTTGCAAACGGTGTGGGGCTACGATTACTTTGGTGACGTCCGGACCGTTGACGTAACGGTGCGTCGGTTGCGTGAAAAAATCGAAGATAACCCGAGTCACCCCCAGTGGCTGATCACGCGGCGGGGGGTCGGTTACTACCTAGCCAACACGAATCAGGATTAA

Protein sequence:

MAKKVLVIDDEKPISDIIKFNLEKEGYEVVVAYDGEEALQKVESESPDLIVLDLMLPKIDGLEVAKQVRAKRSTPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANLRRQDATVSPANDDRTADIKVGDLTIHPDAYTVTKRGENINLTHREFELLHYLAQHIGQVINREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPQWLITRRGVGYYLANTNQD

GenBank Info

locus_tag - FAM19471-i1-1.1_000927
inference - COORDINATES: similar to AA sequence:RefSeq:WP_011953351.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - response regulator transcription factor
protein_id - extdb:FAM19471-i1-1.1_000927

Gene Locus

Located on scaffold FAM19471-i1-1_scf14


FAM19471-i1-1.1_000926
FAM19471-i1-1.1_000928