update range to 10000 bp
locus tag: FAM19471-i1-1.1_001284 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
KEGG reaction
 R09395 thiocarboxylated molybdopterin synthase:cyclic pyranopterin phosphate sulfurtransferase; Precursor Z + 2 Thiocarboxy-[sulfur-carrier protein] <=> Molybdopterin + 2 Sulfur-carrier protein kornec00790kornec01100kornec01240
Ortholog
 N0.HOG0002089 molybdenum cofactor biosynthesis protein MoaE
Gene Product
 molybdenum cofactor biosynthesis protein MoaE
KEGG gene
 K21142 moaX; MoaE-MoaD fusion protein [EC:2.8.1.12] kornec00790kornec01100kornec01240kornec04122
KEGG gene
 K03635 MOCS2B, moaE; molybdopterin synthase catalytic subunit [EC:2.8.1.12] kornec00790kornec01100kornec01240kornec04122
Gene Ontology
 GO:1901657 glycosyl compound metabolic process
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:1901362 organic cyclic compound biosynthetic process
Gene Ontology
 GO:1901360 organic cyclic compound metabolic process
Gene Ontology
 GO:1901135 carbohydrate derivative metabolic process
Gene Ontology
 GO:1901068 guanosine-containing compound metabolic process
Gene Ontology
 GO:0090407 organophosphate biosynthetic process
Gene Ontology
 GO:0072521 purine-containing compound metabolic process
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0055086 nucleobase-containing small molecule metabolic process
Gene Ontology
 GO:0051189 prosthetic group metabolic process
Gene Ontology
 GO:0051188 obsolete cofactor biosynthetic process
Gene Ontology
 GO:0051186 obsolete cofactor metabolic process
Gene Ontology
 GO:0046483 heterocycle metabolic process
Gene Ontology
 GO:0046128 purine ribonucleoside metabolic process
Gene Ontology
 GO:0046039 GTP metabolic process
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044281 small molecule metabolic process
Gene Ontology
 GO:0044267 -
Gene Ontology
 GO:0044260 cellular macromolecule metabolic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0043545 molybdopterin cofactor metabolic process
Gene Ontology
 GO:0043170 macromolecule metabolic process
Gene Ontology
 GO:0042278 purine nucleoside metabolic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0032324 molybdopterin cofactor biosynthetic process
Gene Ontology
 GO:0030366 molybdopterin synthase activity
Gene Ontology
 GO:0019693 ribose phosphate metabolic process
Gene Ontology
 GO:0019637 organophosphate metabolic process
Gene Ontology
 GO:0019538 protein metabolic process
Gene Ontology
 GO:0018130 heterocycle biosynthetic process
Gene Ontology
 GO:0016783 sulfurtransferase activity
Gene Ontology
 GO:0016782 transferase activity, transferring sulphur-containing groups
Gene Ontology
 GO:0016740 transferase activity
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009259 ribonucleotide metabolic process
Gene Ontology
 GO:0009205 purine ribonucleoside triphosphate metabolic process
Gene Ontology
 GO:0009199 ribonucleoside triphosphate metabolic process
Gene Ontology
 GO:0009150 purine ribonucleotide metabolic process
Gene Ontology
 GO:0009144 purine nucleoside triphosphate metabolic process
Gene Ontology
 GO:0009141 nucleoside triphosphate metabolic process
Gene Ontology
 GO:0009119 ribonucleoside metabolic process
Gene Ontology
 GO:0009117 nucleotide metabolic process
Gene Ontology
 GO:0009116 nucleoside metabolic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006796 phosphate-containing compound metabolic process
Gene Ontology
 GO:0006793 phosphorus metabolic process
Gene Ontology
 GO:0006753 nucleoside phosphate metabolic process
Gene Ontology
 GO:0006732 obsolete coenzyme metabolic process
Gene Ontology
 GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
 GO:0006163 purine nucleotide metabolic process
Gene Ontology
 GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
 GO:0005829 cytosol
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:moaE
Eggnog Ortholog
 EO:COG0314
Eggnog Description
 ED:MoaE protein
EC Number
 EC:2.8.1.12 molybdopterin synthase; MPT synthase kornec00790kornec01100

Occurs in the following pathway maps:

Pathway Description
kornec00790 Folate biosynthesis
kornec01100 Metabolic pathways
kornec01240 Biosynthesis of cofactors
kornec04122 Sulfur relay system

Sequences

Nucleotide sequence (GC-content: 50.7 %):

ATGTATTATCTCAGGATTTCAGACGAACCCCTTAACGTTGCGGAACTCTACGCTAAATTGGTTGACCCCAAATACGGGGGCATCGACATGTTTGTCGGGACCATTCGCCAATGGACCGGAGAGATCGAAACGGAACGGATCGTTTACTCAGCCTACCACCCAATGGCTGAGCGACAGTTAGAAAAACTTGCTGAACCAATTGAACAACAGGGCGCCCGGGTGGTGATTGCCCACCGAACCGGCGAACTTCAGTTAACCGAAGAAGCCGTCTTTGTCGGTGTGGCAGCCGCTCACCGGGGCGACGCCTTTAAGTGGTGCCAATACCTAATTGATACCCTTAAGCAGGAAGTCCCAATTTGGAAGCAAGAATTCGACACTGATAAAGTGAGGTGGGGAGAATAA

Protein sequence:

MYYLRISDEPLNVAELYAKLVDPKYGGIDMFVGTIRQWTGEIETERIVYSAYHPMAERQLEKLAEPIEQQGARVVIAHRTGELQLTEEAVFVGVAAAHRGDAFKWCQYLIDTLKQEVPIWKQEFDTDKVRWGE

GenBank Info

locus_tag - FAM19471-i1-1.1_001284
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003683472.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - molybdenum cofactor biosynthesis protein MoaE
protein_id - extdb:FAM19471-i1-1.1_001284

Gene Locus

Located on scaffold FAM19471-i1-1_scf25

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
FAM19471-i1-1.1_001283
FAM19471-i1-1.1_001285