update range to 10000 bp
locus tag: FAM19471-i1-1.1_001328 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
KEGG reaction
 R04463 5'-Phosphoribosylformylglycinamide:L-glutamine amido-ligase (ADP-forming); ATP + 5'-Phosphoribosyl-N-formylglycinamide + L-Glutamine + H2O <=> ADP + Orthophosphate + 2-(Formamido)-N1-(5'-phosphoribosyl)acetamidine + L-Glutamate kornec00230kornec01100kornec01110
Gene Code
 purS
Gene Product
 phosphoribosylformylglycinamidine synthase subunit PurS
Ortholog
 N0.HOG0001584 phosphoribosylformylglycinamidine synthase subunit PurS
KEGG gene
 K01952 PFAS, purL; phosphoribosylformylglycinamidine synthase [EC:6.3.5.3] kornec00230kornec01100kornec01110
Eggnog Protein
 EP:purS
Eggnog Ortholog
 EO:COG1828
Eggnog Description
 ED:Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL
EC Number
 EC:6.3.5.3 phosphoribosylformylglycinamidine synthase; phosphoribosylformylglycinamidine synthetase; formylglycinamide ribonucleotide amidotransferase; phosphoribosylformylglycineamidine synthetase; FGAM synthetase; FGAR amidotransferase; 5'-phosphoribosylformylglycinamide:L-glutamine amido-ligase (ADP-forming); 2-N-formyl-1-N-(5-phospho-D-ribosyl)glycinamide:L-glutamine amido-ligase (ADP-forming) kornec00230kornec01100kornec01110

Occurs in the following pathway maps:

Pathway Description
kornec00230 Purine metabolism
kornec01100 Metabolic pathways
kornec01110 Biosynthesis of secondary metabolites

Sequences

Nucleotide sequence (GC-content: 51.4 %):

ATGACCACCGTTCGGATTTACGTGACCTACAAGCCATCCGTTTTTGACCCCCAGGGGGAAACGATCACCAACTCGATTCACGCCCTCGGCCACCAAGACGTGAAGAGCGTCACCGTCGGCAAGTTCTTTGACGTAACGGTTGACGGCGACCAAGTTGAAGCGACGGTTAAGCAAATTGCCGAGGAACTCTTGGTTAACTTCAACATGGAAACCTACACCTACCAAGTACTGGAGGAGAAGTAA

Protein sequence:

MTTVRIYVTYKPSVFDPQGETITNSIHALGHQDVKSVTVGKFFDVTVDGDQVEATVKQIAEELLVNFNMETYTYQVLEEK

GenBank Info

gene - purS
locus_tag - FAM19471-i1-1.1_001328
EC_number - 6.3.5.3
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003615547.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - phosphoribosylformylglycinamidine synthase subunit PurS
protein_id - extdb:FAM19471-i1-1.1_001328

Gene Locus

Located on scaffold FAM19471-i1-1_scf27

FAM19471-i1-1.1_001327
FAM19471-i1-1.1_001329