Annotations

Type Name Description Pathways
Ortholog
N0.HOG0000928 elongation factor P
KEGG gene
K02356 efp; elongation factor P
Gene Ontology
GO:1901576 organic substance biosynthetic process
Gene Ontology
GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
GO:1901564 organonitrogen compound metabolic process
Gene Ontology
GO:1901363 heterocyclic compound binding
Gene Ontology
GO:0097159 organic cyclic compound binding
Gene Ontology
GO:0071704 organic substance metabolic process
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044424 obsolete intracellular part
Gene Ontology
GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
GO:0044267 -
Gene Ontology
GO:0044260 cellular macromolecule metabolic process
Gene Ontology
GO:0044249 cellular biosynthetic process
Gene Ontology
GO:0044238 primary metabolic process
Gene Ontology
GO:0044237 cellular metabolic process
Gene Ontology
GO:0043604 amide biosynthetic process
Gene Ontology
GO:0043603 cellular amide metabolic process
Gene Ontology
GO:0043170 macromolecule metabolic process
Gene Ontology
GO:0043043 peptide biosynthetic process
Gene Ontology
GO:0034645 cellular macromolecule biosynthetic process
Gene Ontology
GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
GO:0019538 protein metabolic process
Gene Ontology
GO:0010467 gene expression
Gene Ontology
GO:0009987 cellular process
Gene Ontology
GO:0009059 macromolecule biosynthetic process
Gene Ontology
GO:0009058 biosynthetic process
Gene Ontology
GO:0008152 metabolic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0008135 translation factor activity, RNA binding
Gene Ontology
GO:0006807 nitrogen compound metabolic process
Gene Ontology
GO:0006518 peptide metabolic process
Gene Ontology
GO:0006414 translational elongation
Gene Ontology
GO:0006412 translation
Gene Ontology
GO:0005737 cytoplasm
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005622 intracellular anatomical structure
Gene Ontology
GO:0005575 cellular_component
Gene Ontology
GO:0005488 binding
Gene Ontology
GO:0003746 translation elongation factor activity
Gene Ontology
GO:0003723 RNA binding
Gene Ontology
GO:0003676 nucleic acid binding
Gene Ontology
GO:0003674 molecular_function
Eggnog Protein
EP:efp
Eggnog Ortholog
EO:COG0231
Gene Product
elongation factor P
Gene Code
efp
Eggnog Description
ED:Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirectly by altering the affinity of the ribosome for aminoacyl-tRNA

Sequences

Nucleotide sequence (GC-content: 49.1 %):

ATGATTCAAACGATTGACTTGAAGAAGGGTATGGTCTTTGAAAAGGACGGCAAGCTGCTCAAGGTGCTCGCCATCAACCACCACAAGCCAGGTAAGGGTAACACCCTGATGCAAATGGATATCCAAGACGTTCGTTCTGGCTCAATTGTGCACACCACGATGCGCCCATCTGAAAAGGTGGAACAAGTGATGGTTAACAAGAAGAACGCTCAATACCTTTACGACGAAGGTAACACGTCCGTCTTCATGGACCTGGAAACTTACGAACAATACGAAATCGACCAATCCCAAATCAGCGAAGAAAAGAAGTACCTGACGGAAAACATGCAAGTACAAATGAACTTCGTTGACAGCGAACTGGTCGGGGTTGAATTGCCAGCTACGGTGACCTTAGAAGTCGTGGAAACCCAACCGGAAATCAAGGGGGCCACGATTGACGGTGGTGGTAAGCCAGCTACGATGAACACTGGCCTGGTCGTAACGGTGCCATCCTTCGTTAAGAACGGCGACAAGATCATCGTCAACACGTCTGACGGTGCTTACAAGTCCCGCGCATAG

Protein sequence:

MIQTIDLKKGMVFEKDGKLLKVLAINHHKPGKGNTLMQMDIQDVRSGSIVHTTMRPSEKVEQVMVNKKNAQYLYDEGNTSVFMDLETYEQYEIDQSQISEEKKYLTENMQVQMNFVDSELVGVELPATVTLEVVETQPEIKGATIDGGGKPATMNTGLVVTVPSFVKNGDKIIVNTSDGAYKSRA

GenBank Info

gene - efp
locus_tag - FAM19471-i1-1.1_001351
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003674998.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - elongation factor P
protein_id - extdb:FAM19471-i1-1.1_001351

Gene Locus

Located on scaffold FAM19471-i1-1_scf28


Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm

FAM19471-i1-1.1_001350
FAM19471-i1-1.1_001352