update range to 10000 bp
locus tag: FAM19471-i1-1.1_001498 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
Gene Code
 rnpA
Gene Product
 ribonuclease P protein component
Ortholog
 N0.HOG0001305 ribonuclease P protein component
KEGG gene
 K03536 rnpA; ribonuclease P protein component [EC:3.1.26.5]
Gene Ontology
 GO:1990904 ribonucleoprotein complex
Gene Ontology
 GO:1905348 endonuclease complex
Gene Ontology
 GO:1905267 endonucleolytic cleavage involved in tRNA processing
Gene Ontology
 GO:1902555 endoribonuclease complex
Gene Ontology
 GO:1902494 catalytic complex
Gene Ontology
 GO:1901681 sulfur compound binding
Gene Ontology
 GO:1901363 heterocyclic compound binding
Gene Ontology
 GO:1901360 organic cyclic compound metabolic process
Gene Ontology
 GO:0140101 catalytic activity, acting on a tRNA
Gene Ontology
 GO:0140098 catalytic activity, acting on RNA
Gene Ontology
 GO:0097159 organic cyclic compound binding
Gene Ontology
 GO:0090502 RNA phosphodiester bond hydrolysis, endonucleolytic
Gene Ontology
 GO:0090501 RNA phosphodiester bond hydrolysis
Gene Ontology
 GO:0090305 nucleic acid phosphodiester bond hydrolysis
Gene Ontology
 GO:0090304 nucleic acid metabolic process
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0046483 heterocycle metabolic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0043628 small regulatory ncRNA 3'-end processing
Gene Ontology
 GO:0043199 sulfate binding
Gene Ontology
 GO:0043170 macromolecule metabolic process
Gene Ontology
 GO:0043168 anion binding
Gene Ontology
 GO:0043167 ion binding
Gene Ontology
 GO:0042781 3'-tRNA processing endoribonuclease activity
Gene Ontology
 GO:0042780 tRNA 3'-end processing
Gene Ontology
 GO:0042779 tRNA 3'-trailer cleavage
Gene Ontology
 GO:0042301 phosphate ion binding
Gene Ontology
 GO:0034660 ncRNA metabolic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0034470 ncRNA processing
Gene Ontology
 GO:0034414 tRNA 3'-trailer cleavage, endonucleolytic
Gene Ontology
 GO:0033204 ribonuclease P RNA binding
Gene Ontology
 GO:0032991 protein-containing complex
Gene Ontology
 GO:0031404 chloride ion binding
Gene Ontology
 GO:0031123 RNA 3'-end processing
Gene Ontology
 GO:0030677 ribonuclease P complex
Gene Ontology
 GO:0016893 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 5'-phosphomonoesters
Gene Ontology
 GO:0016891 endoribonuclease activity, producing 5'-phosphomonoesters
Gene Ontology
 GO:0016788 hydrolase activity, acting on ester bonds
Gene Ontology
 GO:0016787 hydrolase activity
Gene Ontology
 GO:0016070 RNA metabolic process
Gene Ontology
 GO:0010467 gene expression
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0008033 tRNA processing
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
 GO:0006399 tRNA metabolic process
Gene Ontology
 GO:0006396 RNA processing
Gene Ontology
 GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005488 binding
Gene Ontology
 GO:0004549 tRNA-specific ribonuclease activity
Gene Ontology
 GO:0004540 ribonuclease activity
Gene Ontology
 GO:0004526 ribonuclease P activity
Gene Ontology
 GO:0004521 endoribonuclease activity
Gene Ontology
 GO:0004519 endonuclease activity
Gene Ontology
 GO:0004518 nuclease activity
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003723 RNA binding
Gene Ontology
 GO:0003676 nucleic acid binding
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:rnpA
Eggnog Ortholog
 EO:COG0594
Eggnog Description
 ED:RNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme
EC Number
 EC:3.1.26.5 ribonuclease P; RNase P

Sequences

Nucleotide sequence (GC-content: 48.4 %):

ATGAAAAAATCGTACCGAATAAAAAAGGAAAGCGACTTCCAACGGGTGTTTGAAACTCATAATTCAGTGGCCAATCATAAGTTTGTGATCTACCAGATGCAAAAACCGAACCAACCCCACTTCCGGGTCGGGATTTCGGTCGGTAAAAAGGTGGGCAACGCCGTCCAGCGGGGCTGGGTCAAACGACGGATCCGCCAAACCCTGCTCGAGGTTAAGCCCGAATTAAAGCAGGACGTTGACTTCTTGGTAATCGCCCGTAAATCGGCGGCCGACCTTTCAATGAAGGAAATCAAGAAGAATCTGGTCCATGCACTTACGTTGGCACACCTGTTTGAGGAAAAGTAA

Protein sequence:

MKKSYRIKKESDFQRVFETHNSVANHKFVIYQMQKPNQPHFRVGISVGKKVGNAVQRGWVKRRIRQTLLEVKPELKQDVDFLVIARKSAADLSMKEIKKNLVHALTLAHLFEEK

GenBank Info

gene - rnpA
locus_tag - FAM19471-i1-1.1_001498
EC_number - 3.1.26.5
inference - COORDINATES: similar to AA sequence:RefSeq:WP_007123732.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - ribonuclease P protein component
protein_id - extdb:FAM19471-i1-1.1_001498

Gene Locus

Located on scaffold FAM19471-i1-1_scf33

FAM19471-i1-1.1_001497
FAM19471-i1-1.1_001499