Annotations

Type Name Description Pathways
Gene Product
ribosome-associated translation inhibitor RaiA
Gene Code
raiA
Ortholog
N0.HOG0001163 ribosome-associated translation inhibitor RaiA
KEGG gene
K05808 yhbH; putative sigma-54 modulation protein
Gene Ontology
GO:2000113 negative regulation of cellular macromolecule biosynthetic process
Gene Ontology
GO:2000112 regulation of cellular macromolecule biosynthetic process
Gene Ontology
GO:1990904 ribonucleoprotein complex
Gene Ontology
GO:0080090 regulation of primary metabolic process
Gene Ontology
GO:0065007 biological regulation
Gene Ontology
GO:0060255 regulation of macromolecule metabolic process
Gene Ontology
GO:0051248 negative regulation of protein metabolic process
Gene Ontology
GO:0051246 regulation of protein metabolic process
Gene Ontology
GO:0051172 negative regulation of nitrogen compound metabolic process
Gene Ontology
GO:0051171 regulation of nitrogen compound metabolic process
Gene Ontology
GO:0050794 regulation of cellular process
Gene Ontology
GO:0050789 regulation of biological process
Gene Ontology
GO:0048523 negative regulation of cellular process
Gene Ontology
GO:0048519 negative regulation of biological process
Gene Ontology
GO:0045900 negative regulation of translational elongation
Gene Ontology
GO:0044877 protein-containing complex binding
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044446 obsolete intracellular organelle part
Gene Ontology
GO:0044445 obsolete cytosolic part
Gene Ontology
GO:0044444 obsolete cytoplasmic part
Gene Ontology
GO:0044424 obsolete intracellular part
Gene Ontology
GO:0044422 obsolete organelle part
Gene Ontology
GO:0044391 ribosomal subunit
Gene Ontology
GO:0043232 intracellular non-membrane-bounded organelle
Gene Ontology
GO:0043229 intracellular organelle
Gene Ontology
GO:0043228 non-membrane-bounded organelle
Gene Ontology
GO:0043226 organelle
Gene Ontology
GO:0043024 ribosomal small subunit binding
Gene Ontology
GO:0043022 ribosome binding
Gene Ontology
GO:0043021 ribonucleoprotein complex binding
Gene Ontology
GO:0034249 negative regulation of cellular amide metabolic process
Gene Ontology
GO:0034248 regulation of cellular amide metabolic process
Gene Ontology
GO:0032991 protein-containing complex
Gene Ontology
GO:0032269 -
Gene Ontology
GO:0032268 regulation of cellular protein metabolic process
Gene Ontology
GO:0031327 negative regulation of cellular biosynthetic process
Gene Ontology
GO:0031326 regulation of cellular biosynthetic process
Gene Ontology
GO:0031324 negative regulation of cellular metabolic process
Gene Ontology
GO:0031323 regulation of cellular metabolic process
Gene Ontology
GO:0022627 cytosolic small ribosomal subunit
Gene Ontology
GO:0022626 cytosolic ribosome
Gene Ontology
GO:0019222 regulation of metabolic process
Gene Ontology
GO:0017148 negative regulation of translation
Gene Ontology
GO:0015935 small ribosomal subunit
Gene Ontology
GO:0010629 negative regulation of gene expression
Gene Ontology
GO:0010608 post-transcriptional regulation of gene expression
Gene Ontology
GO:0010605 negative regulation of macromolecule metabolic process
Gene Ontology
GO:0010558 negative regulation of macromolecule biosynthetic process
Gene Ontology
GO:0010556 regulation of macromolecule biosynthetic process
Gene Ontology
GO:0010468 regulation of gene expression
Gene Ontology
GO:0009892 negative regulation of metabolic process
Gene Ontology
GO:0009890 negative regulation of biosynthetic process
Gene Ontology
GO:0009889 regulation of biosynthetic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0006448 regulation of translational elongation
Gene Ontology
GO:0006417 regulation of translation
Gene Ontology
GO:0005840 ribosome
Gene Ontology
GO:0005829 cytosol
Gene Ontology
GO:0005737 cytoplasm
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005622 intracellular anatomical structure
Gene Ontology
GO:0005575 cellular_component
Gene Ontology
GO:0005488 binding
Gene Ontology
GO:0003674 molecular_function
Eggnog Protein
EP:hpf
Eggnog Ortholog
EO:COG1544
Eggnog Description
ED:Required for dimerization of active 70S ribosomes into 100S ribosomes in stationary phase

Sequences

Nucleotide sequence (GC-content: 35.2 %):

ATGATTAAATATAGTATCCGTGGTGAAAACATCGAAGTAACTGAAGCACTTCGTGACTATGTTGAAAGTAAACTTAGCAAAGTTGAAAAATACTTCCACGAAGACCAAGAACTACATGCACGAGTAAATCTTAAGGTTTATCGCGAAAAGACAGCTAAAGTAGAAGTTACTATCCCTACAGGTTCTGTAACACTACGTGCAGAAGATGTTTCACTAGATATGTATGGTTCTATTGACCTAGTGGTCGATAAGATTGCAAGACAAATCCGTAAAAATAAAACAAAAATTGCACGTAAGTATCGTGAGAAAGTTCCAACCGGTGAAATGTTCTCGACTGAATTCAATAAAGAAGAAGTTGAAGAAGCACCAGCTGTTGAAGTTGTGAGAATTAAAAATATTGAGTTGAAACCAATGGATGTTGAAGAAGCAATTCTTCAAATGGAGTTGTTGGGACACGATTTCTTTATTTATACTGATAGCAAAGATCATACAACTAACGTACTATATAAGCGTGAAGATGGTAACTATGGCTTGATTGAAGCAAAATAA

Protein sequence:

MIKYSIRGENIEVTEALRDYVESKLSKVEKYFHEDQELHARVNLKVYREKTAKVEVTIPTGSVTLRAEDVSLDMYGSIDLVVDKIARQIRKNKTKIARKYREKVPTGEMFSTEFNKEEVEEAPAVEVVRIKNIELKPMDVEEAILQMELLGHDFFIYTDSKDHTTNVLYKREDGNYGLIEAK

GenBank Info

gene - raiA
locus_tag - FAM13496-i1-1.1_001349
inference - COORDINATES: similar to AA sequence:RefSeq:WP_002988974.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - ribosome-associated translation inhibitor RaiA
protein_id - extdb:FAM13496-i1-1.1_001349

Gene Locus

Located on scaffold FAM13496-i1-1_scf18


Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol

FAM13496-i1-1.1_001348
FAM13496-i1-1.1_001350