Annotations

Type Name Description Pathways
KEGG reaction
R01665 ATP:dCMP phosphotransferase; ATP + dCMP <=> ADP + dCDP kornec00240kornec01100
KEGG reaction
R00512 ATP:CMP phosphotransferase; ATP + CMP <=> ADP + CDP kornec00240kornec01100
KEGG reaction
R00158 ATP:UMP phosphotransferase; ATP + UMP <=> ADP + UDP kornec00240kornec01100kornec01240
Ortholog
N0.HOG0001213 (d)CMP kinase
KEGG gene
K00945 cmk; CMP/dCMP kinase [EC:2.7.4.25] kornec00240kornec01100
Gene Ontology
GO:1901605 alpha-amino acid metabolic process
Gene Ontology
GO:1901576 organic substance biosynthetic process
Gene Ontology
GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
GO:1901564 organonitrogen compound metabolic process
Gene Ontology
GO:1901362 organic cyclic compound biosynthetic process
Gene Ontology
GO:1901360 organic cyclic compound metabolic process
Gene Ontology
GO:1901293 nucleoside phosphate biosynthetic process
Gene Ontology
GO:0090407 organophosphate biosynthetic process
Gene Ontology
GO:0072330 monocarboxylic acid biosynthetic process
Gene Ontology
GO:0071704 organic substance metabolic process
Gene Ontology
GO:0055086 nucleobase-containing small molecule metabolic process
Gene Ontology
GO:0051188 obsolete cofactor biosynthetic process
Gene Ontology
GO:0051186 obsolete cofactor metabolic process
Gene Ontology
GO:0050145 nucleoside monophosphate kinase activity
Gene Ontology
GO:0046940 nucleoside monophosphate phosphorylation
Gene Ontology
GO:0046939 nucleotide phosphorylation
Gene Ontology
GO:0046483 heterocycle metabolic process
Gene Ontology
GO:0046394 carboxylic acid biosynthetic process
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044444 obsolete cytoplasmic part
Gene Ontology
GO:0044424 obsolete intracellular part
Gene Ontology
GO:0044283 small molecule biosynthetic process
Gene Ontology
GO:0044281 small molecule metabolic process
Gene Ontology
GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
GO:0044249 cellular biosynthetic process
Gene Ontology
GO:0044238 primary metabolic process
Gene Ontology
GO:0044237 cellular metabolic process
Gene Ontology
GO:0043604 amide biosynthetic process
Gene Ontology
GO:0043603 cellular amide metabolic process
Gene Ontology
GO:0043436 oxoacid metabolic process
Gene Ontology
GO:0042398 cellular modified amino acid biosynthetic process
Gene Ontology
GO:0042364 water-soluble vitamin biosynthetic process
Gene Ontology
GO:0034654 nucleobase-containing compound biosynthetic process
Gene Ontology
GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
GO:0033317 -
Gene Ontology
GO:0032787 monocarboxylic acid metabolic process
Gene Ontology
GO:0019752 carboxylic acid metabolic process
Gene Ontology
GO:0019637 organophosphate metabolic process
Gene Ontology
GO:0019438 aromatic compound biosynthetic process
Gene Ontology
GO:0019205 nucleobase-containing compound kinase activity
Gene Ontology
GO:0018130 heterocycle biosynthetic process
Gene Ontology
GO:0016881 acid-amino acid ligase activity
Gene Ontology
GO:0016879 ligase activity, forming carbon-nitrogen bonds
Gene Ontology
GO:0016874 ligase activity
Gene Ontology
GO:0016776 phosphotransferase activity, phosphate group as acceptor
Gene Ontology
GO:0016772 transferase activity, transferring phosphorus-containing groups
Gene Ontology
GO:0016740 transferase activity
Gene Ontology
GO:0016310 phosphorylation
Gene Ontology
GO:0016301 kinase activity
Gene Ontology
GO:0016053 organic acid biosynthetic process
Gene Ontology
GO:0015940 pantothenate biosynthetic process
Gene Ontology
GO:0015939 pantothenate metabolic process
Gene Ontology
GO:0009987 cellular process
Gene Ontology
GO:0009165 nucleotide biosynthetic process
Gene Ontology
GO:0009123 nucleoside monophosphate metabolic process
Gene Ontology
GO:0009117 nucleotide metabolic process
Gene Ontology
GO:0009110 vitamin biosynthetic process
Gene Ontology
GO:0009108 obsolete coenzyme biosynthetic process
Gene Ontology
GO:0009081 branched-chain amino acid metabolic process
Gene Ontology
GO:0009058 biosynthetic process
Gene Ontology
GO:0008152 metabolic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0006807 nitrogen compound metabolic process
Gene Ontology
GO:0006796 phosphate-containing compound metabolic process
Gene Ontology
GO:0006793 phosphorus metabolic process
Gene Ontology
GO:0006767 water-soluble vitamin metabolic process
Gene Ontology
GO:0006766 vitamin metabolic process
Gene Ontology
GO:0006753 nucleoside phosphate metabolic process
Gene Ontology
GO:0006732 obsolete coenzyme metabolic process
Gene Ontology
GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
GO:0006575 cellular modified amino acid metabolic process
Gene Ontology
GO:0006573 valine metabolic process
Gene Ontology
GO:0006520 cellular amino acid metabolic process
Gene Ontology
GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
GO:0006082 organic acid metabolic process
Gene Ontology
GO:0005829 cytosol
Gene Ontology
GO:0005737 cytoplasm
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005622 intracellular anatomical structure
Gene Ontology
GO:0005575 cellular_component
Gene Ontology
GO:0004592 pantoate-beta-alanine ligase activity
Gene Ontology
GO:0004127 cytidylate kinase activity
Gene Ontology
GO:0003824 catalytic activity
Gene Ontology
GO:0003674 molecular_function
Eggnog Protein
EP:cmk
Eggnog Ortholog
EO:COG0283
Eggnog Description
ED:Belongs to the cytidylate kinase family. Type 1 subfamily
EC Number
EC:2.7.4.25 (d)CMP kinase; cmk (gene name); prokaryotic cytidylate kinase; deoxycytidylate kinase (misleading); dCMP kinase (misleading); deoxycytidine monophosphokinase (misleading) kornec00240kornec01100
Gene Product
(d)CMP kinase

Occurs in the following pathway maps:

Pathway Description
kornec00240 Pyrimidine metabolism
kornec01100 Metabolic pathways
kornec01240 Biosynthesis of cofactors

Sequences

Nucleotide sequence (GC-content: 56.8 %):

ATGGTAAAGGGAATTCAAGTTGCAATTGACGGGCCGGCTTCGGCGGGAAAGAGTACGGTCGCCAAGCTCGTGGCCAAGCGCTTCGGGTACATTTACTGTGACACCGGGGCGATGTACCGGTCGGTAACCCTGGCCGCTTTAGAGCGGGGAATTGATTTAAGCCAAGATGACTTGGTGAGTGAACTGGCTAACCAAATCACGATCACCTTCGCCCCCGGCGACCCACAAAAGGTCTTCATCGACGGGCATGAGGTTACCCAGGCGATTCGGTCGACGGAAGTGGCTCAGCACGTTTCGACGGTGGCCGCCATTCCAGCCGTGCGGAGCCGGATGGTGGAATTGCAACGTCAAATTGCCCAAGAGGGCGGGATCGTGATGGACGGCCGTGACATTGGGACGACCGTCCTCCCGGATGCCCCGGTCAAAATCTTTATGGTGGCCTCGGCACACGAACGGGCCCGGCGCCGCTTCTTGGATAACCAAGAGCGGGGGATCGACGGTGGTTCAATTGAAGAACTCCAACGGGCGATCGAACTACGGGATCAAAAGGATTCCACCCGGGCGGTTTCTCCGCTCGTTAAAGCCGCGGACGCCTATCAACTCGACACCACTCACCTGACCATTGAGCAAGTGGTCGATCAGATTGCCGGTCGAATTGAAAAAACACTGGAACAAAAATAG

Protein sequence:

MVKGIQVAIDGPASAGKSTVAKLVAKRFGYIYCDTGAMYRSVTLAALERGIDLSQDDLVSELANQITITFAPGDPQKVFIDGHEVTQAIRSTEVAQHVSTVAAIPAVRSRMVELQRQIAQEGGIVMDGRDIGTTVLPDAPVKIFMVASAHERARRRFLDNQERGIDGGSIEELQRAIELRDQKDSTRAVSPLVKAADAYQLDTTHLTIEQVVDQIAGRIEKTLEQK

GenBank Info

locus_tag - FAM19471-i1-1.1_000793
EC_number - 2.7.4.25
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003684936.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - (d)CMP kinase
protein_id - extdb:FAM19471-i1-1.1_000793

Gene Locus

Located on scaffold FAM19471-i1-1_scf11


Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol

FAM19471-i1-1.1_000792
FAM19471-i1-1.1_000794