Annotations

Type Name Description Pathways
Gene Product
SUF system NifU family Fe-S cluster assembly protein
Ortholog
N0.HOG0001352 SUF system NifU family Fe-S cluster assembly protein
KEGG gene
K04488 iscU, nifU; nitrogen fixation protein NifU and related proteins
Gene Ontology
GO:1901564 organonitrogen compound metabolic process
Gene Ontology
GO:0098771 inorganic ion homeostasis
Gene Ontology
GO:0097428 protein maturation by iron-sulfur cluster transfer
Gene Ontology
GO:0071704 organic substance metabolic process
Gene Ontology
GO:0065008 regulation of biological quality
Gene Ontology
GO:0065007 biological regulation
Gene Ontology
GO:0055082 cellular chemical homeostasis
Gene Ontology
GO:0055080 cation homeostasis
Gene Ontology
GO:0055076 transition metal ion homeostasis
Gene Ontology
GO:0055072 iron ion homeostasis
Gene Ontology
GO:0055065 metal ion homeostasis
Gene Ontology
GO:0051604 protein maturation
Gene Ontology
GO:0051540 metal cluster binding
Gene Ontology
GO:0051539 4 iron, 4 sulfur cluster binding
Gene Ontology
GO:0051537 2 iron, 2 sulfur cluster binding
Gene Ontology
GO:0051536 iron-sulfur cluster binding
Gene Ontology
GO:0050801 ion homeostasis
Gene Ontology
GO:0048878 chemical homeostasis
Gene Ontology
GO:0048037 obsolete cofactor binding
Gene Ontology
GO:0046916 cellular transition metal ion homeostasis
Gene Ontology
GO:0046914 transition metal ion binding
Gene Ontology
GO:0046872 metal ion binding
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044424 obsolete intracellular part
Gene Ontology
GO:0044238 primary metabolic process
Gene Ontology
GO:0043170 macromolecule metabolic process
Gene Ontology
GO:0043169 cation binding
Gene Ontology
GO:0043167 ion binding
Gene Ontology
GO:0042592 homeostatic process
Gene Ontology
GO:0036455 iron-sulfur transferase activity
Gene Ontology
GO:0030003 cellular cation homeostasis
Gene Ontology
GO:0019725 cellular homeostasis
Gene Ontology
GO:0019538 protein metabolic process
Gene Ontology
GO:0016782 transferase activity, transferring sulphur-containing groups
Gene Ontology
GO:0016740 transferase activity
Gene Ontology
GO:0010467 gene expression
Gene Ontology
GO:0009987 cellular process
Gene Ontology
GO:0008198 ferrous iron binding
Gene Ontology
GO:0008152 metabolic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0006879 cellular iron ion homeostasis
Gene Ontology
GO:0006875 cellular metal ion homeostasis
Gene Ontology
GO:0006873 cellular ion homeostasis
Gene Ontology
GO:0006807 nitrogen compound metabolic process
Gene Ontology
GO:0005737 cytoplasm
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005622 intracellular anatomical structure
Gene Ontology
GO:0005575 cellular_component
Gene Ontology
GO:0005506 iron ion binding
Gene Ontology
GO:0005488 binding
Gene Ontology
GO:0003824 catalytic activity
Gene Ontology
GO:0003674 molecular_function
Eggnog Protein
EP:nifU
Eggnog Ortholog
EO:COG0822
Eggnog Description
ED:SUF system FeS assembly protein

Sequences

Nucleotide sequence (GC-content: 51.4 %):

TTGGGACTATCTAAGTTAAATAATTTATACCGGGAGGTTATCTTAGACCACGCTGATCACCCCCACAACAAGGGAGCCTTAAAGGACGCCACTAACGCCATTACCTTAAATAACCCGACTTGTGGTGACGAAATCGACTTGCAAGTCAAGGTAGGTTCAGATGGCTTAATTGACGAAATTGGCTATACCGGTCACGGCTGCACGATTTCACAGGCATCGGCGTCGATGATGACTGAAGCCGTCAAGGGGAAGCGCCCAGACGAGGCTCTGGCAATGGCTAAGATCTTTTCGGACATGGCGATCGGTAAGGACCATGATCAAGCGGACCTACAAGCGTTAGGGGACGCCCAGGTGCTAACCAGCATCATGGAATTCCCCGCCCGCATCAAGTGTGCCACCCTAGCTTGGTGGGCCTTACAGCGGGCACTGTTAAAGGACACTGATGAGGAGGATATTGATGACCAAGGCTAG

Protein sequence:

MGLSKLNNLYREVILDHADHPHNKGALKDATNAITLNNPTCGDEIDLQVKVGSDGLIDEIGYTGHGCTISQASASMMTEAVKGKRPDEALAMAKIFSDMAIGKDHDQADLQALGDAQVLTSIMEFPARIKCATLAWWALQRALLKDTDEEDIDDQG

GenBank Info

locus_tag - FAM19471-i1-1.1_001231
inference - COORDINATES: similar to AA sequence:RefSeq:WP_012391345.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - SUF system NifU family Fe-S cluster assembly protein
protein_id - extdb:FAM19471-i1-1.1_001231

Gene Locus

Located on scaffold FAM19471-i1-1_scf23


Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm

FAM19471-i1-1.1_001230
FAM19471-i1-1.1_001232