Annotations

Type Name Description Pathways
KEGG reaction
R01518 D-phosphoglycerate 2,3-phosphomutase; 2-Phospho-D-glycerate <=> 3-Phospho-D-glycerate kornec00010kornec00260kornec00680kornec01100kornec01110kornec01120kornec01200kornec01230
Ortholog
N0.HOG0000852 phosphoglyceromutase
KEGG gene
K01834 PGAM, gpmA; 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11] kornec00010kornec00260kornec00680kornec01100kornec01110kornec01120kornec01200kornec01230kornec04922kornec05230
Gene Ontology
GO:2001065 mannan binding
Gene Ontology
GO:1902031 regulation of NADP metabolic process
Gene Ontology
GO:1901576 organic substance biosynthetic process
Gene Ontology
GO:1901575 organic substance catabolic process
Gene Ontology
GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
GO:1901564 organonitrogen compound metabolic process
Gene Ontology
GO:1901362 organic cyclic compound biosynthetic process
Gene Ontology
GO:1901361 organic cyclic compound catabolic process
Gene Ontology
GO:1901360 organic cyclic compound metabolic process
Gene Ontology
GO:1901293 nucleoside phosphate biosynthetic process
Gene Ontology
GO:1901292 nucleoside phosphate catabolic process
Gene Ontology
GO:1901137 carbohydrate derivative biosynthetic process
Gene Ontology
GO:1901135 carbohydrate derivative metabolic process
Gene Ontology
GO:0090407 organophosphate biosynthetic process
Gene Ontology
GO:0080090 regulation of primary metabolic process
Gene Ontology
GO:0072525 pyridine-containing compound biosynthetic process
Gene Ontology
GO:0072524 pyridine-containing compound metabolic process
Gene Ontology
GO:0072522 purine-containing compound biosynthetic process
Gene Ontology
GO:0072521 purine-containing compound metabolic process
Gene Ontology
GO:0072330 monocarboxylic acid biosynthetic process
Gene Ontology
GO:0071704 organic substance metabolic process
Gene Ontology
GO:0065007 biological regulation
Gene Ontology
GO:0062012 regulation of small molecule metabolic process
Gene Ontology
GO:0060255 regulation of macromolecule metabolic process
Gene Ontology
GO:0055086 nucleobase-containing small molecule metabolic process
Gene Ontology
GO:0051196 obsolete regulation of coenzyme metabolic process
Gene Ontology
GO:0051193 obsolete regulation of cofactor metabolic process
Gene Ontology
GO:0051188 obsolete cofactor biosynthetic process
Gene Ontology
GO:0051186 obsolete cofactor metabolic process
Gene Ontology
GO:0051174 regulation of phosphorus metabolic process
Gene Ontology
GO:0051171 regulation of nitrogen compound metabolic process
Gene Ontology
GO:0050794 regulation of cellular process
Gene Ontology
GO:0050789 regulation of biological process
Gene Ontology
GO:0046939 nucleotide phosphorylation
Gene Ontology
GO:0046700 heterocycle catabolic process
Gene Ontology
GO:0046538 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase activity
Gene Ontology
GO:0046496 nicotinamide nucleotide metabolic process
Gene Ontology
GO:0046483 heterocycle metabolic process
Gene Ontology
GO:0046434 organophosphate catabolic process
Gene Ontology
GO:0046394 carboxylic acid biosynthetic process
Gene Ontology
GO:0046390 ribose phosphate biosynthetic process
Gene Ontology
GO:0046364 monosaccharide biosynthetic process
Gene Ontology
GO:0046034 ATP metabolic process
Gene Ontology
GO:0046031 ADP metabolic process
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044444 obsolete cytoplasmic part
Gene Ontology
GO:0044424 obsolete intracellular part
Gene Ontology
GO:0044283 small molecule biosynthetic process
Gene Ontology
GO:0044281 small molecule metabolic process
Gene Ontology
GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
GO:0044270 cellular nitrogen compound catabolic process
Gene Ontology
GO:0044249 cellular biosynthetic process
Gene Ontology
GO:0044248 cellular catabolic process
Gene Ontology
GO:0044238 primary metabolic process
Gene Ontology
GO:0044237 cellular metabolic process
Gene Ontology
GO:0043471 regulation of cellular carbohydrate catabolic process
Gene Ontology
GO:0043470 regulation of carbohydrate catabolic process
Gene Ontology
GO:0043456 regulation of pentose-phosphate shunt
Gene Ontology
GO:0043455 regulation of secondary metabolic process
Gene Ontology
GO:0043436 oxoacid metabolic process
Gene Ontology
GO:0042866 pyruvate biosynthetic process
Gene Ontology
GO:0034655 nucleobase-containing compound catabolic process
Gene Ontology
GO:0034654 nucleobase-containing compound biosynthetic process
Gene Ontology
GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
GO:0034404 nucleobase-containing small molecule biosynthetic process
Gene Ontology
GO:0034248 regulation of cellular amide metabolic process
Gene Ontology
GO:0032787 monocarboxylic acid metabolic process
Gene Ontology
GO:0031329 regulation of cellular catabolic process
Gene Ontology
GO:0031323 regulation of cellular metabolic process
Gene Ontology
GO:0030247 polysaccharide binding
Gene Ontology
GO:0030246 carbohydrate binding
Gene Ontology
GO:0019752 carboxylic acid metabolic process
Gene Ontology
GO:0019693 ribose phosphate metabolic process
Gene Ontology
GO:0019637 organophosphate metabolic process
Gene Ontology
GO:0019439 aromatic compound catabolic process
Gene Ontology
GO:0019438 aromatic compound biosynthetic process
Gene Ontology
GO:0019363 pyridine nucleotide biosynthetic process
Gene Ontology
GO:0019362 pyridine nucleotide metabolic process
Gene Ontology
GO:0019359 nicotinamide nucleotide biosynthetic process
Gene Ontology
GO:0019319 hexose biosynthetic process
Gene Ontology
GO:0019318 hexose metabolic process
Gene Ontology
GO:0019222 regulation of metabolic process
Gene Ontology
GO:0019220 regulation of phosphate metabolic process
Gene Ontology
GO:0019219 regulation of nucleobase-containing compound metabolic process
Gene Ontology
GO:0018130 heterocycle biosynthetic process
Gene Ontology
GO:0017144 -
Gene Ontology
GO:0016868 intramolecular transferase activity, phosphotransferases
Gene Ontology
GO:0016866 intramolecular transferase activity
Gene Ontology
GO:0016853 isomerase activity
Gene Ontology
GO:0016310 phosphorylation
Gene Ontology
GO:0016053 organic acid biosynthetic process
Gene Ontology
GO:0016052 carbohydrate catabolic process
Gene Ontology
GO:0016051 carbohydrate biosynthetic process
Gene Ontology
GO:0010675 regulation of cellular carbohydrate metabolic process
Gene Ontology
GO:0009987 cellular process
Gene Ontology
GO:0009986 cell surface
Gene Ontology
GO:0009894 regulation of catabolic process
Gene Ontology
GO:0009260 ribonucleotide biosynthetic process
Gene Ontology
GO:0009259 ribonucleotide metabolic process
Gene Ontology
GO:0009206 purine ribonucleoside triphosphate biosynthetic process
Gene Ontology
GO:0009205 purine ribonucleoside triphosphate metabolic process
Gene Ontology
GO:0009201 ribonucleoside triphosphate biosynthetic process
Gene Ontology
GO:0009199 ribonucleoside triphosphate metabolic process
Gene Ontology
GO:0009185 ribonucleoside diphosphate metabolic process
Gene Ontology
GO:0009179 purine ribonucleoside diphosphate metabolic process
Gene Ontology
GO:0009168 purine ribonucleoside monophosphate biosynthetic process
Gene Ontology
GO:0009167 purine ribonucleoside monophosphate metabolic process
Gene Ontology
GO:0009166 nucleotide catabolic process
Gene Ontology
GO:0009165 nucleotide biosynthetic process
Gene Ontology
GO:0009161 ribonucleoside monophosphate metabolic process
Gene Ontology
GO:0009156 ribonucleoside monophosphate biosynthetic process
Gene Ontology
GO:0009152 purine ribonucleotide biosynthetic process
Gene Ontology
GO:0009150 purine ribonucleotide metabolic process
Gene Ontology
GO:0009145 purine nucleoside triphosphate biosynthetic process
Gene Ontology
GO:0009144 purine nucleoside triphosphate metabolic process
Gene Ontology
GO:0009142 nucleoside triphosphate biosynthetic process
Gene Ontology
GO:0009141 nucleoside triphosphate metabolic process
Gene Ontology
GO:0009135 purine nucleoside diphosphate metabolic process
Gene Ontology
GO:0009132 nucleoside diphosphate metabolic process
Gene Ontology
GO:0009127 purine nucleoside monophosphate biosynthetic process
Gene Ontology
GO:0009126 purine nucleoside monophosphate metabolic process
Gene Ontology
GO:0009124 nucleoside monophosphate biosynthetic process
Gene Ontology
GO:0009123 nucleoside monophosphate metabolic process
Gene Ontology
GO:0009117 nucleotide metabolic process
Gene Ontology
GO:0009108 obsolete coenzyme biosynthetic process
Gene Ontology
GO:0009058 biosynthetic process
Gene Ontology
GO:0009056 catabolic process
Gene Ontology
GO:0008152 metabolic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0006807 nitrogen compound metabolic process
Gene Ontology
GO:0006796 phosphate-containing compound metabolic process
Gene Ontology
GO:0006793 phosphorus metabolic process
Gene Ontology
GO:0006757 ATP generation from ADP
Gene Ontology
GO:0006754 ATP biosynthetic process
Gene Ontology
GO:0006753 nucleoside phosphate metabolic process
Gene Ontology
GO:0006733 obsolete oxidoreduction coenzyme metabolic process
Gene Ontology
GO:0006732 obsolete coenzyme metabolic process
Gene Ontology
GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
GO:0006165 nucleoside diphosphate phosphorylation
Gene Ontology
GO:0006164 purine nucleotide biosynthetic process
Gene Ontology
GO:0006163 purine nucleotide metabolic process
Gene Ontology
GO:0006140 regulation of nucleotide metabolic process
Gene Ontology
GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
GO:0006109 regulation of carbohydrate metabolic process
Gene Ontology
GO:0006096 glycolytic process
Gene Ontology
GO:0006094 gluconeogenesis
Gene Ontology
GO:0006091 generation of precursor metabolites and energy
Gene Ontology
GO:0006090 pyruvate metabolic process
Gene Ontology
GO:0006082 organic acid metabolic process
Gene Ontology
GO:0006006 glucose metabolic process
Gene Ontology
GO:0005996 monosaccharide metabolic process
Gene Ontology
GO:0005975 carbohydrate metabolic process
Gene Ontology
GO:0005829 cytosol
Gene Ontology
GO:0005737 cytoplasm
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005622 intracellular anatomical structure
Gene Ontology
GO:0005575 cellular_component
Gene Ontology
GO:0005488 binding
Gene Ontology
GO:0004619 phosphoglycerate mutase activity
Gene Ontology
GO:0003824 catalytic activity
Gene Ontology
GO:0003674 molecular_function
Gene Ontology
GO:0001871 obsolete pattern binding
Eggnog Protein
EP:gpmA
Eggnog Ortholog
EO:COG0588
Eggnog Description
ED:Catalyzes the interconversion of 2-phosphoglycerate and 3-phosphoglycerate
EC Number
EC:5.4.2.11 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent); glycerate phosphomutase (diphosphoglycerate cofactor); 2,3-diphosphoglycerate dependent phosphoglycerate mutase; cofactor dependent phosphoglycerate mutase; phosphoglycerate phosphomutase (ambiguous); phosphoglyceromutase (ambiguous); monophosphoglycerate mutase (ambiguous); monophosphoglyceromutase (ambiguous); GriP mutase (ambiguous); PGA mutase (ambiguous); MPGM; PGAM; PGAM-d; PGM; dPGM kornec00010kornec00260kornec00680kornec01100kornec01110kornec01120
Gene Product
2-3-diphosphoglycerate-dependent phosphoglycerate mutase

Occurs in the following pathway maps:

Pathway Description
kornec00010 Glycolysis / Gluconeogenesis
kornec00260 Glycine, serine and threonine metabolism
kornec00680 Methane metabolism
kornec01100 Metabolic pathways
kornec01110 Biosynthesis of secondary metabolites
kornec01120 Microbial metabolism in diverse environments
kornec01200 Carbon metabolism
kornec01230 Biosynthesis of amino acids
kornec04922 Glucagon signaling pathway
kornec05230 Central carbon metabolism in cancer

Sequences

Nucleotide sequence (GC-content: 52.7 %):

ATGGCTAAATTAGTACTGATTCGTCACGGGCAAAGCGAATGGAACCTGTCCAACCTGTTTACTGGCTGGGTTGACGTCGACCTGAGCGAAAAGGGTGTTGAACAAGCAAAAGCCGCCGGTAAGGCGATCAAGGAACACGGGCTGGAATTTGATTACGCCTACACTTCTGTTTTGAAGCGGGCAATCAAGACCCTCCACTACGCACTGGAAGAATCCGACCAAATGTGGATCCCAGAATTCAAGACTTGGCGCTTGAACGAACGTCACTACGGGGCATTGCAAGGCAAGAACAAGGCCGACGCCGCTGAAAAGTACGGTGACGAACAAGTGCACATTTGGCGCCGTTCTTACGACGTGCTGCCGCCGCTGCTGAGTGCTGATGACGAAGGTTCTGCCGCAAAGGACCGTCGTTACGCTGACTTGGACCCACGCGCCATTCCGGGTGGGGAAAACTTGAAGGTCACCCTGGAACGGGTAATCCCGCTTTGGCAAGACGAAATCGCACCAAAGCTCTTGGACGGCAAGAACGTGATCATCGCCGCCCACGGTAACTCCCTGCGTGCCTTGAGCAAGTACATCGAAAACATCTCCGACGAAGACATCATGGGCTTGGAAATGGCTACTGGTCAACCGGTCGTTTACGACTTCGATGAAAAGCTGAACGTGCTCAGCAAGGAAAAGTACGACATTGATTAA

Protein sequence:

MAKLVLIRHGQSEWNLSNLFTGWVDVDLSEKGVEQAKAAGKAIKEHGLEFDYAYTSVLKRAIKTLHYALEESDQMWIPEFKTWRLNERHYGALQGKNKADAAEKYGDEQVHIWRRSYDVLPPLLSADDEGSAAKDRRYADLDPRAIPGGENLKVTLERVIPLWQDEIAPKLLDGKNVIIAAHGNSLRALSKYIENISDEDIMGLEMATGQPVVYDFDEKLNVLSKEKYDID

GenBank Info

locus_tag - FAM19471-i1-1.1_001336
EC_number - 5.4.2.11
inference - COORDINATES: similar to AA sequence:RefSeq:WP_006917583.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 2,3-diphosphoglycerate-dependent phosphoglycerate mutase
protein_id - extdb:FAM19471-i1-1.1_001336

Gene Locus

Located on scaffold FAM19471-i1-1_scf27


Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
SL-0310: GO:0009986 cell surface

FAM19471-i1-1.1_001335
FAM19471-i1-1.1_001337