update range to 10000 bp
locus tag: FAM19471-i1-1.1_001422 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
KEGG reaction
 R04457 5-amino-6-(D-ribitylamino)uracil butanedionetransferase; 5-Amino-6-(1-D-ribitylamino)uracil + L-3,4-Dihydroxybutan-2-one 4-phosphate <=> 6,7-Dimethyl-8-(D-ribityl)lumazine + 2 H2O + Orthophosphate kornec00740kornec01100kornec01110kornec01240
Ortholog
 N0.HOG0001754 6,7-dimethyl-8-ribityllumazine synthase
KEGG gene
 K00794 ribH, RIB4; 6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78] kornec00740kornec01100kornec01110kornec01240
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:1901362 organic cyclic compound biosynthetic process
Gene Ontology
 GO:1901360 organic cyclic compound metabolic process
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0046483 heterocycle metabolic process
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044283 small molecule biosynthetic process
Gene Ontology
 GO:0044281 small molecule metabolic process
Gene Ontology
 GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0042727 flavin-containing compound biosynthetic process
Gene Ontology
 GO:0042726 flavin-containing compound metabolic process
Gene Ontology
 GO:0042364 water-soluble vitamin biosynthetic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0018130 heterocycle biosynthetic process
Gene Ontology
 GO:0017144 -
Gene Ontology
 GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups
Gene Ontology
 GO:0016740 transferase activity
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009231 riboflavin biosynthetic process
Gene Ontology
 GO:0009110 vitamin biosynthetic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006771 riboflavin metabolic process
Gene Ontology
 GO:0006767 water-soluble vitamin metabolic process
Gene Ontology
 GO:0006766 vitamin metabolic process
Gene Ontology
 GO:0005829 cytosol
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0000906 6,7-dimethyl-8-ribityllumazine synthase activity
Eggnog Protein
 EP:ribH
Eggnog Ortholog
 EO:COG0054
Eggnog Description
 ED:Catalyzes the formation of 6
EC Number
 EC:2.5.1.78 6,7-dimethyl-8-ribityllumazine synthase; lumazine synthase; 6,7-dimethyl-8-ribityllumazine synthase 2; 6,7-dimethyl-8-ribityllumazine synthase 1; lumazine synthase 2; lumazine synthase 1; type I lumazine synthase; type II lumazine synthase; RIB4; MJ0303; RibH; Pbls; MbtLS; RibH1 protein; RibH2 protein; RibH1; RibH2 kornec00740kornec01100kornec01110
Gene Product
 6-7-dimethyl-8-ribityllumazine synthase

Occurs in the following pathway maps:

Pathway Description
kornec00740 Riboflavin metabolism
kornec01100 Metabolic pathways
kornec01110 Biosynthesis of secondary metabolites
kornec01240 Biosynthesis of cofactors

Sequences

Nucleotide sequence (GC-content: 55.4 %):

ATGCCTAACCAATTCGAAGGAAACTTTATCACCACCCCCACCAAGAAGATCGCGATCGTCGTTGGTAAATTCAACGAATCCGTCACCCGCAACCTAGCCGACGGGGCGATCCGGACCCTAAAGCAATTCGGGATCAAGGACGACCAAATTGACCTCGTCTGGGTGCCAGGCGCCTTTGAAATCGCCTTTGCCGCCAAGAAACTGGTCGCCAGCGGCCGCTACGCCGGGGTGATGACCTTGGGCGCCGTGATCAAGGGCGAAACCGACCACTACGACCTGATCTGCCAGTCCACCACCAGCGCAATCATGAACTTAAATGCTCAGGGCACGATTCCGGTGACCTTCGGGATTTTGACCACCGACACGATCGAACAGGCGATGCAACGGGCCGGCTTAAAGGTCGGCAACGAGGGTTCGATGACTGCCCAATCGCTGCTGGAAATGATTAGCTTAAACGAACAACTAGGGTAA

Protein sequence:

MPNQFEGNFITTPTKKIAIVVGKFNESVTRNLADGAIRTLKQFGIKDDQIDLVWVPGAFEIAFAAKKLVASGRYAGVMTLGAVIKGETDHYDLICQSTTSAIMNLNAQGTIPVTFGILTTDTIEQAMQRAGLKVGNEGSMTAQSLLEMISLNEQLG

GenBank Info

locus_tag - FAM19471-i1-1.1_001422
EC_number - 2.5.1.78
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003681855.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 6,7-dimethyl-8-ribityllumazine synthase
protein_id - extdb:FAM19471-i1-1.1_001422

Gene Locus

Located on scaffold FAM19471-i1-1_scf30

Cellular location expand

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol
FAM19471-i1-1.1_001421
FAM19471-i1-1.1_001423